Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEVXTP5)

DME Name Hypoxanthine phosphoribosyltransferase (HPRT1)
Synonyms Hypoxanthine-guanine phosphoribosyltransferase; HGPRT; HGPRTase; HPRT; HPRT1
Gene Name HPRT1
UniProt ID
HPRT_HUMAN
INTEDE ID
DME0223
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
3251
EC Number EC: 2.4.2.8
Transferase
Glycosyltransferases
Pentosyltransferase
EC: 2.4.2.8
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Function This enzyme converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. It transfers the 5-phosphoribosyl group from 5- phosphoribosylpyrophosphate onto the purine.
KEGG Pathway
Drug metabolism - other enzymes (hsa00983 )
Metabolic pathways (hsa01100 )
Purine metabolism (hsa00230 )
Reactome Pathway
Purine salvage (R-HSA-74217 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Thioguanine DM7NKEV Acute lymphocytic leukaemia 2B33.3 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.78E-02 3.32E-02 1.68E-01
Alopecia ED70 Skin from scalp 3.72E-01 -3.59E-03 -2.35E-02
Alzheimer's disease 8A20 Entorhinal cortex 2.90E-07 -2.53E-01 -6.95E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.60E-01 1.13E-01 7.35E-01
Aortic stenosis BB70 Calcified aortic valve 8.12E-01 2.32E-02 3.46E-02
Apnea 7A40 Hyperplastic tonsil 2.49E-01 -1.19E-01 -3.47E-01
Arthropathy FA00-FA5Z Peripheral blood 1.18E-01 -6.16E-02 -5.17E-01
Asthma CA23 Nasal and bronchial airway 1.67E-05 6.54E-02 1.23E-01
Atopic dermatitis EA80 Skin 5.27E-02 5.58E-02 7.22E-01
Autism 6A02 Whole blood 5.37E-01 -4.07E-02 -1.88E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.38E-02 -2.02E-01 -1.27E+00
Autosomal dominant monocytopenia 4B04 Whole blood 8.27E-01 1.15E-01 6.31E-01
Bacterial infection of gingival 1C1H Gingival tissue 8.90E-07 -1.12E-01 -6.99E-01
Batten disease 5C56.1 Whole blood 3.73E-01 -4.80E-02 -5.43E-01
Behcet's disease 4A62 Peripheral blood 6.18E-01 -4.68E-03 -4.22E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.35E-01 -4.83E-02 -2.09E-01
Bladder cancer 2C94 Bladder tissue 1.54E-04 2.59E-01 2.41E+00
Breast cancer 2C60-2C6Z Breast tissue 8.75E-85 6.23E-01 1.86E+00
Cardioembolic stroke 8B11.20 Whole blood 1.34E-05 1.95E-01 1.25E+00
Cervical cancer 2C77 Cervical tissue 4.84E-06 3.28E-01 1.27E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.51E-01 -7.19E-02 -1.66E-01
Chronic hepatitis C 1E51.1 Whole blood 3.88E-01 -5.14E-02 -6.04E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.00E-01 -1.02E-01 -4.64E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.76E-02 -4.33E-02 -2.45E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.90E-01 1.18E-01 8.50E-01
Colon cancer 2B90 Colon tissue 2.20E-49 4.50E-01 1.84E+00
Coronary artery disease BA80-BA8Z Peripheral blood 5.66E-01 2.40E-01 8.48E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.01E-01 1.73E-01 4.13E-01
Endometriosis GA10 Endometrium tissue 1.89E-06 -5.37E-01 -1.13E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.87E-02 1.42E-01 1.25E+00
Familial hypercholesterolemia 5C80.00 Whole blood 7.15E-09 5.59E-01 1.77E+00
Gastric cancer 2B72 Gastric tissue 4.08E-01 2.62E-02 3.24E-02
Glioblastopma 2A00.00 Nervous tissue 5.70E-96 -8.02E-01 -1.68E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.68E-02 -3.80E-01 -4.43E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.40E-02 5.08E-01 1.27E+00
Head and neck cancer 2D42 Head and neck tissue 1.76E-41 5.59E-01 2.42E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.05E-01 -6.33E-01 -1.02E+00
Huntington's disease 8A01.10 Whole blood 1.00E-01 -1.88E-01 -8.71E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.52E-01 1.88E-01 8.18E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.35E-03 1.77E-01 1.68E+00
Influenza 1E30 Whole blood 2.61E-01 -1.85E-01 -9.77E-01
Interstitial cystitis GC00.3 Bladder tissue 5.05E-03 2.60E-01 2.17E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.66E-02 1.65E-01 7.76E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.11E-01 6.39E-02 3.15E-01
Ischemic stroke 8B11 Peripheral blood 7.34E-01 -8.86E-03 -8.38E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 4.79E-01 4.20E-02 1.79E-01
Lateral sclerosis 8B60.4 Skin 8.88E-01 1.00E-01 1.17E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 9.84E-01 -6.69E-02 -8.24E-02
Liver cancer 2C12.0 Liver tissue 3.10E-01 2.83E-03 1.23E-02
Liver failure DB99.7-DB99.8 Liver tissue 1.66E-02 -1.45E-01 -1.16E+00
Lung cancer 2C25 Lung tissue 4.40E-101 5.71E-01 2.74E+00
Lupus erythematosus 4A40 Whole blood 7.88E-01 3.50E-02 1.47E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.18E-01 2.72E-02 1.33E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.47E-01 -1.74E-02 -8.32E-02
Melanoma 2C30 Skin 1.33E-01 9.67E-02 3.76E-01
Multiple myeloma 2A83.1 Peripheral blood 3.83E-01 -6.73E-02 -1.49E-01
Multiple myeloma 2A83.1 Bone marrow 2.20E-07 1.14E+00 6.27E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.97E-01 -1.52E-01 -3.38E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.08E-01 4.64E-03 3.88E-02
Myelofibrosis 2A20.2 Whole blood 1.92E-01 1.04E-01 5.50E-01
Myocardial infarction BA41-BA50 Peripheral blood 6.16E-01 -3.77E-02 -1.20E-01
Myopathy 8C70.6 Muscle tissue 2.38E-02 2.64E-01 1.05E+00
Neonatal sepsis KA60 Whole blood 3.92E-06 1.92E-01 6.90E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 9.95E-04 6.04E-01 1.59E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.11E-01 -1.23E-01 -3.73E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.90E-01 -1.22E-01 -3.26E-01
Olive pollen allergy CA08.00 Peripheral blood 8.24E-02 -9.20E-02 -5.93E-01
Oral cancer 2B6E Oral tissue 1.53E-07 7.72E-01 1.65E+00
Osteoarthritis FA00-FA0Z Synovial tissue 3.43E-01 1.34E-01 5.93E-01
Osteoporosis FB83.1 Bone marrow 8.14E-01 5.55E-02 1.94E-01
Ovarian cancer 2C73 Ovarian tissue 2.19E-03 4.90E-01 1.52E+00
Pancreatic cancer 2C10 Pancreas 7.59E-01 -1.33E-03 -8.04E-03
Parkinson's disease 8A00.0 Substantia nigra tissue 1.40E-01 -4.62E-01 -8.16E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.04E-05 1.11E-01 1.46E+00
Pituitary cancer 2D12 Pituitary tissue 2.50E-02 1.75E-01 6.12E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.56E-02 2.65E-01 1.07E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.76E-01 -7.10E-03 -4.10E-02
Polycythemia vera 2A20.4 Whole blood 1.19E-02 -3.60E-02 -1.85E-01
Pompe disease 5C51.3 Biceps muscle 2.76E-01 5.53E-02 3.87E-01
Preterm birth KA21.4Z Myometrium 2.70E-01 -1.54E-01 -5.02E-01
Prostate cancer 2C82 Prostate 5.73E-01 -4.06E-02 -1.09E-01
Psoriasis EA90 Skin 1.57E-03 -5.75E-02 -3.64E-01
Rectal cancer 2B92 Rectal colon tissue 1.79E-04 2.26E-01 2.63E+00
Renal cancer 2C90-2C91 Kidney 1.92E-01 8.74E-02 4.57E-01
Retinoblastoma 2D02.2 Uvea 7.73E-07 -8.26E-01 -8.24E+00
Rheumatoid arthritis FA20 Synovial tissue 7.63E-01 5.06E-02 2.53E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.74E-01 -5.68E-03 -5.17E-02
Schizophrenia 6A20 Prefrontal cortex 3.05E-03 -1.92E-01 -4.99E-01
Schizophrenia 6A20 Superior temporal cortex 4.82E-01 1.55E-02 3.77E-02
Scleroderma 4A42.Z Whole blood 9.62E-02 6.36E-02 8.67E-01
Seizure 8A60-8A6Z Whole blood 1.33E-01 2.51E-01 1.12E+00
Sensitive skin EK0Z Skin 2.47E-01 6.26E-04 9.49E-03
Sepsis with septic shock 1G41 Whole blood 2.21E-03 8.07E-03 3.18E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.03E-02 -2.28E-01 -1.47E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.55E-01 -1.17E-01 -3.12E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 3.66E-02 2.55E-01 3.35E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.21E-05 1.53E-01 9.43E+00
Skin cancer 2C30-2C3Z Skin 2.17E-07 7.51E-02 3.67E-01
Thrombocythemia 3B63 Whole blood 1.04E-01 -6.88E-03 -3.61E-02
Thrombocytopenia 3B64 Whole blood 4.53E-01 -3.21E-01 -7.02E-01
Thyroid cancer 2D10 Thyroid 2.81E-02 2.16E-02 1.36E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.17E-03 1.83E-01 9.16E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.97E-03 -5.66E-01 -4.82E+00
Type 2 diabetes 5A11 Liver tissue 8.43E-01 -1.99E-01 -5.21E-01
Ureter cancer 2C92 Urothelium 9.75E-01 -1.15E-01 -4.68E-01
Uterine cancer 2C78 Endometrium tissue 4.36E-07 2.43E-01 5.48E-01
Vitiligo ED63.0 Skin 2.93E-01 -1.07E-02 -9.53E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Qualitative and quantitative difference in mutation induction between carbon- and neon-ion beams in normal human cells. Biol Sci Space. 2003 Dec;17(4):302-6.