Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEWJATF)

DME Name Adenosine 5'-monophosphoramidase (HINT1)
Synonyms Histidine triad nucleotide-binding protein 1; HINT; HINT1; PKCI-1; PKCI1; PRKCNH1; Protein kinase C inhibitor 1; Protein kinase C-interacting protein 1
Gene Name HINT1
UniProt ID
HINT1_HUMAN
INTEDE ID
DME0215
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
3094
EC Number EC: 3.2.1.45
Hydrolases
Glycosylase
O/S-glycosyl compound glycosidase
EC: 3.2.1.45
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHI
SQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQ
MHWPPG
Function
This enzyme hydrolyzes purine nucleotide phosphoramidates with a single phosphate group, including adenosine 5'monophosphoramidate (AMP-NH2), adenosine 5'monophosphomorpholidate (AMP-morpholidate) and guanosine 5'monophosphomorpholidate (GMP-morpholidate). It hydrolyzes lysyl-AMP (AMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) generated by lysine tRNA ligase, as well as Met-AMP, His-AMP and Asp-AMP, lysyl-GMP (GMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) and AMP-N-alanine methyl ester. It can also convert adenosine 5'-O-phosphorothioate and guanosine 5'-O-phosphorothioate to the corresponding nucleoside 5'-O- phosphates with concomitant release of hydrogen sulfide.

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
PSI-7977 DMLSUWZ HCV 1-6 infection 1E51 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.64E-39 6.10E-01 2.62E+00
Alopecia ED70 Skin from scalp 3.43E-01 6.05E-02 3.78E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.97E-08 -3.71E-01 -1.10E+00
Ankylosing spondylitis FA92.0 Pheripheral blood 3.54E-02 1.25E-01 6.85E-01
Aortic stenosis BB70 Calcified aortic valve 9.05E-01 -6.15E-02 -5.80E-02
Apnea 7A40 Hyperplastic tonsil 4.27E-01 -2.36E-01 -3.16E-01
Arthropathy FA00-FA5Z Peripheral blood 7.18E-01 2.17E-02 3.07E-02
Asthma CA23 Nasal and bronchial airway 2.01E-05 1.11E-01 2.99E-01
Atopic dermatitis EA80 Skin 3.12E-02 -1.59E-01 -1.27E+00
Autism 6A02 Whole blood 2.71E-01 6.08E-01 6.85E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.21E-01 -3.92E-01 -1.20E+00
Autosomal dominant monocytopenia 4B04 Whole blood 2.50E-02 4.20E-01 6.59E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.28E-08 -1.96E-01 -9.33E-01
Batten disease 5C56.1 Whole blood 6.02E-01 -2.75E-02 -1.42E-01
Behcet's disease 4A62 Peripheral blood 2.22E-01 -1.24E-01 -6.88E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.05E-02 -8.84E-02 -3.17E-01
Bladder cancer 2C94 Bladder tissue 6.35E-01 3.49E-02 2.50E-01
Breast cancer 2C60-2C6Z Breast tissue 5.02E-09 3.29E-01 9.74E-01
Cardioembolic stroke 8B11.20 Whole blood 1.49E-03 3.67E-01 1.01E+00
Cervical cancer 2C77 Cervical tissue 1.46E-01 1.15E-01 2.97E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.82E-01 -1.96E-01 -1.59E-01
Chronic hepatitis C 1E51.1 Whole blood 9.38E-01 -6.04E-02 -3.50E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.31E-01 -8.42E-02 -3.32E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.49E-01 7.25E-02 3.00E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.13E-01 -1.41E-01 -3.27E-01
Colon cancer 2B90 Colon tissue 1.25E-31 -1.66E-01 -1.06E+00
Coronary artery disease BA80-BA8Z Peripheral blood 1.49E-02 1.20E+00 2.91E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.64E-01 -1.30E-01 -5.02E-01
Endometriosis GA10 Endometrium tissue 5.41E-03 -2.31E-01 -5.96E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.13E-01 -5.68E-03 -6.10E-02
Familial hypercholesterolemia 5C80.00 Whole blood 1.37E-14 1.13E+00 1.75E+00
Gastric cancer 2B72 Gastric tissue 7.54E-02 4.38E-01 1.92E+00
Glioblastopma 2A00.00 Nervous tissue 6.04E-48 -4.66E-01 -1.12E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 4.60E-02 -1.48E-01 -3.15E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.39E-06 9.70E-01 2.45E+00
Head and neck cancer 2D42 Head and neck tissue 9.22E-12 -2.25E-01 -8.80E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.77E-01 -2.24E-01 -4.45E-01
Huntington's disease 8A01.10 Whole blood 2.89E-01 -1.58E-01 -5.11E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.54E-02 1.70E-01 1.08E+00
Immunodeficiency 4A00-4A20 Peripheral blood 1.85E-01 -4.26E-03 -4.95E-02
Influenza 1E30 Whole blood 5.79E-01 1.16E-01 4.60E-01
Interstitial cystitis GC00.3 Bladder tissue 3.88E-02 -2.28E-01 -1.39E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.80E-01 -1.50E-01 -7.07E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.18E-01 -1.62E-01 -7.34E-01
Ischemic stroke 8B11 Peripheral blood 2.51E-01 4.14E-02 2.03E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.98E-01 -7.34E-02 -1.20E-01
Lateral sclerosis 8B60.4 Skin 4.53E-02 1.40E-01 1.63E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 7.90E-01 3.62E-02 3.65E-02
Liver cancer 2C12.0 Liver tissue 7.67E-01 7.26E-02 2.68E-01
Liver failure DB99.7-DB99.8 Liver tissue 8.18E-03 -7.03E-01 -5.15E+00
Lung cancer 2C25 Lung tissue 5.94E-02 6.47E-02 2.63E-01
Lupus erythematosus 4A40 Whole blood 4.57E-01 5.71E-01 5.72E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.90E-01 -1.09E-01 -4.68E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.47E-03 -1.27E-01 -2.54E-01
Melanoma 2C30 Skin 7.79E-03 -7.78E-02 -2.77E-01
Multiple myeloma 2A83.1 Peripheral blood 5.62E-01 2.80E-02 7.78E-02
Multiple myeloma 2A83.1 Bone marrow 6.07E-05 1.37E+00 3.42E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.32E-02 -2.82E-01 -1.61E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.86E-01 -1.12E-02 -3.80E-02
Myelofibrosis 2A20.2 Whole blood 3.76E-01 1.67E-01 2.85E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.95E-02 -1.88E-01 -4.94E-01
Myopathy 8C70.6 Muscle tissue 2.80E-01 1.05E-01 9.73E-01
Neonatal sepsis KA60 Whole blood 2.30E-01 -1.14E-01 -1.37E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.97E-05 7.15E-01 1.97E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 9.69E-01 -3.27E-02 -1.70E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.48E-05 -4.07E-01 -4.64E+00
Olive pollen allergy CA08.00 Peripheral blood 8.59E-01 -3.98E-01 -4.35E-01
Oral cancer 2B6E Oral tissue 5.14E-01 -7.62E-03 -1.93E-02
Osteoarthritis FA00-FA0Z Synovial tissue 5.31E-01 2.60E-01 2.66E-01
Osteoporosis FB83.1 Bone marrow 7.51E-02 -1.14E-01 -1.10E+00
Ovarian cancer 2C73 Ovarian tissue 3.32E-03 4.71E-01 1.46E+00
Pancreatic cancer 2C10 Pancreas 2.53E-01 2.36E-01 8.08E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.15E-01 -1.02E-01 -2.21E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.72E-04 -2.76E-01 -1.37E+00
Pituitary cancer 2D12 Pituitary tissue 1.83E-02 2.99E-01 1.36E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.99E-01 1.30E-01 6.06E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.77E-01 -9.73E-02 -5.84E-01
Polycythemia vera 2A20.4 Whole blood 2.95E-03 -3.36E-01 -5.74E-01
Pompe disease 5C51.3 Biceps muscle 1.49E-02 3.40E-01 4.08E+00
Preterm birth KA21.4Z Myometrium 3.04E-01 1.31E-01 1.12E+00
Prostate cancer 2C82 Prostate 1.51E-02 3.90E-02 1.64E-01
Psoriasis EA90 Skin 8.71E-01 3.05E-02 1.61E-01
Rectal cancer 2B92 Rectal colon tissue 1.49E-03 -3.34E-01 -2.17E+00
Renal cancer 2C90-2C91 Kidney 7.66E-03 3.91E-01 1.50E+00
Retinoblastoma 2D02.2 Uvea 1.94E-02 4.03E-01 1.44E+00
Rheumatoid arthritis FA20 Synovial tissue 1.78E-02 2.61E-01 6.40E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.90E-01 2.25E-02 2.08E-01
Schizophrenia 6A20 Prefrontal cortex 3.28E-04 -1.37E-01 -4.44E-01
Schizophrenia 6A20 Superior temporal cortex 5.95E-01 -1.43E-01 -3.49E-01
Scleroderma 4A42.Z Whole blood 8.93E-01 2.70E-01 5.25E-01
Seizure 8A60-8A6Z Whole blood 4.06E-02 7.55E-01 8.73E-01
Sensitive skin EK0Z Skin 7.82E-01 3.22E-02 3.59E-01
Sepsis with septic shock 1G41 Whole blood 1.42E-04 -4.52E-01 -5.51E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.99E-03 -4.60E-01 -5.61E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.54E-02 -6.46E-01 -1.05E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 9.86E-01 3.84E-02 1.47E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.06E-01 -5.19E-01 -1.80E+00
Skin cancer 2C30-2C3Z Skin 4.62E-18 -1.91E-01 -9.78E-01
Thrombocythemia 3B63 Whole blood 9.01E-03 -3.07E-01 -5.39E-01
Thrombocytopenia 3B64 Whole blood 3.62E-01 8.56E-02 2.74E-01
Thyroid cancer 2D10 Thyroid 4.33E-04 -9.68E-02 -3.81E-01
Tibial muscular dystrophy 8C75 Muscle tissue 8.31E-02 -4.89E-02 -2.26E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.32E-02 -5.83E-01 -2.56E+00
Type 2 diabetes 5A11 Liver tissue 6.58E-01 2.84E-02 2.87E-01
Ureter cancer 2C92 Urothelium 1.09E-01 3.22E-01 6.62E-01
Uterine cancer 2C78 Endometrium tissue 2.11E-04 -1.10E-01 -2.47E-01
Vitiligo ED63.0 Skin 2.79E-01 2.47E-02 3.09E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Mechanism of activation of PSI-7851 and its diastereoisomer PSI-7977. J Biol Chem. 2010 Nov 5;285(45):34337-47.