Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEWJYTE)

DME Name Uridine 5'-monophosphate synthase (UMPS)
Synonyms Orotate phosphoribosyltransferase; Orotidine 5'-phosphate decarboxylase; UMP synthase; OMPdecase; ODC; OK/SW-cl.21; OPRT; OPRTase; UMPS
Gene Name UMPS
UniProt ID
UMPS_HUMAN
INTEDE ID
DME0138
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
7372
EC Number EC: 4.1.1.23
Lyases
Carbon-carbon lyase
Carboxy-lyase
EC: 4.1.1.23
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQT
AQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCL
IIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKML
EILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVA
SKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELIT
LAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLP
LHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQ
LEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV
Function
This enzyme catalyzes the final two reactions of the de novo biosynthesis of UMP in mammalian cells by the sequential action of orotate phosphoribosyltransferase and orotidine 5'-monophosphate (OMP) decarboxylase.
KEGG Pathway
Drug metabolism - other enzymes (hsa00983 )
Metabolic pathways (hsa01100 )
Pyrimidine metabolism (hsa00240 )
Reactome Pathway
Pyrimidine biosynthesis (R-HSA-500753 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Fluorouracil DMUM7HZ Adenocarcinoma 2D40 Approved [5]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.72E-09 -2.29E-01 -6.51E-01
Alopecia ED70 Skin from scalp 4.45E-02 1.17E-01 5.16E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.16E-04 -7.00E-02 -5.60E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.33E-01 1.69E-01 9.47E-01
Aortic stenosis BB70 Calcified aortic valve 9.97E-01 -8.81E-02 -3.30E-01
Apnea 7A40 Hyperplastic tonsil 1.45E-01 -1.64E-01 -3.73E-01
Arthropathy FA00-FA5Z Peripheral blood 7.31E-02 -1.87E-01 -1.39E+00
Asthma CA23 Nasal and bronchial airway 2.66E-02 1.29E-01 3.36E-01
Atopic dermatitis EA80 Skin 5.65E-01 6.56E-02 2.87E-01
Autism 6A02 Whole blood 6.13E-01 3.79E-03 1.45E-02
Autoimmune uveitis 9A96 Peripheral monocyte 5.18E-01 9.14E-02 5.64E-01
Autosomal dominant monocytopenia 4B04 Whole blood 5.91E-01 -4.49E-02 -3.12E-01
Bacterial infection of gingival 1C1H Gingival tissue 6.04E-11 -1.87E-01 -1.17E+00
Batten disease 5C56.1 Whole blood 9.77E-01 -5.77E-03 -3.40E-02
Behcet's disease 4A62 Peripheral blood 9.38E-01 -1.06E-01 -3.91E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.43E-01 4.28E-02 2.83E-01
Bladder cancer 2C94 Bladder tissue 1.57E-01 7.11E-02 5.32E-01
Breast cancer 2C60-2C6Z Breast tissue 3.00E-10 8.49E-02 2.30E-01
Cardioembolic stroke 8B11.20 Whole blood 1.07E-05 -2.81E-01 -1.44E+00
Cervical cancer 2C77 Cervical tissue 2.87E-01 4.62E-02 1.95E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.80E-01 5.34E-02 9.95E-02
Chronic hepatitis C 1E51.1 Whole blood 1.00E-02 1.62E-01 1.32E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 1.36E-01 -3.19E-02 -2.13E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.80E-01 5.24E-02 2.54E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.03E-01 -6.63E-03 -6.49E-02
Colon cancer 2B90 Colon tissue 4.84E-33 3.15E-01 1.34E+00
Coronary artery disease BA80-BA8Z Peripheral blood 7.09E-02 1.77E-01 1.12E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.98E-01 1.72E-01 4.68E-01
Endometriosis GA10 Endometrium tissue 4.43E-01 -5.25E-02 -1.56E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.21E-01 2.30E-02 1.83E-01
Familial hypercholesterolemia 5C80.00 Whole blood 8.83E-03 1.70E-01 6.90E-01
Gastric cancer 2B72 Gastric tissue 5.24E-02 4.97E-01 1.81E+00
Glioblastopma 2A00.00 Nervous tissue 1.22E-171 6.81E-01 2.42E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 4.25E-05 6.84E-01 1.05E+01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.52E-03 5.59E-01 1.44E+00
Head and neck cancer 2D42 Head and neck tissue 1.09E-13 2.39E-01 1.07E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.59E-01 -1.14E-01 -8.11E-01
Huntington's disease 8A01.10 Whole blood 2.09E-01 -1.38E-01 -8.75E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.72E-01 -2.42E-02 -1.25E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.05E-01 -1.59E-02 -1.11E-01
Influenza 1E30 Whole blood 1.64E-02 -7.56E-01 -4.17E+00
Interstitial cystitis GC00.3 Bladder tissue 8.81E-02 -1.57E-01 -2.54E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.01E-02 1.45E-01 5.75E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.64E-01 3.35E-03 1.58E-02
Ischemic stroke 8B11 Peripheral blood 6.28E-01 -1.44E-01 -3.86E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 9.38E-08 -1.94E-01 -6.74E-01
Lateral sclerosis 8B60.4 Skin 3.33E-01 6.47E-02 1.11E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 4.34E-01 -1.47E-02 -8.66E-02
Liver cancer 2C12.0 Liver tissue 6.11E-01 -3.37E-02 -1.11E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.12E-02 -5.62E-01 -2.43E+00
Lung cancer 2C25 Lung tissue 3.64E-55 2.81E-01 1.59E+00
Lupus erythematosus 4A40 Whole blood 1.77E-01 5.13E-02 1.06E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.99E-01 7.34E-02 4.74E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.23E-01 -2.37E-02 -1.07E-01
Melanoma 2C30 Skin 3.86E-01 -1.86E-01 -5.01E-01
Multiple myeloma 2A83.1 Peripheral blood 3.37E-01 -2.19E-01 -3.40E-01
Multiple myeloma 2A83.1 Bone marrow 7.24E-07 3.19E-01 3.69E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.26E-01 -2.20E-01 -6.41E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.11E-03 1.75E-01 4.90E-01
Myelofibrosis 2A20.2 Whole blood 3.34E-02 -1.18E-01 -1.09E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.84E-06 -3.22E-01 -7.81E-01
Myopathy 8C70.6 Muscle tissue 8.16E-01 4.43E-02 2.24E-01
Neonatal sepsis KA60 Whole blood 1.22E-15 -2.95E-01 -1.14E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.83E-10 1.27E+00 6.56E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.81E-02 4.23E-01 5.59E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.11E-01 -2.66E-02 -1.19E-01
Olive pollen allergy CA08.00 Peripheral blood 7.71E-01 7.01E-02 5.67E-01
Oral cancer 2B6E Oral tissue 2.66E-03 3.49E-01 6.21E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.62E-01 1.68E-01 5.88E-01
Osteoporosis FB83.1 Bone marrow 1.88E-01 -7.10E-02 -4.29E-01
Ovarian cancer 2C73 Ovarian tissue 4.28E-05 4.92E-01 2.77E+00
Pancreatic cancer 2C10 Pancreas 8.72E-01 -1.39E-02 -7.95E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 1.71E-01 -9.53E-02 -4.42E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.61E-01 3.14E-02 1.70E-01
Pituitary cancer 2D12 Pituitary tissue 1.20E-09 7.38E-01 3.65E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.70E-10 8.18E-01 5.48E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.46E-01 -2.57E-02 -2.00E-01
Polycythemia vera 2A20.4 Whole blood 1.76E-11 -1.72E-01 -1.57E+00
Pompe disease 5C51.3 Biceps muscle 1.77E-02 -1.78E-01 -1.38E+00
Preterm birth KA21.4Z Myometrium 8.07E-01 -8.09E-02 -2.98E-01
Prostate cancer 2C82 Prostate 9.86E-08 5.52E-01 1.81E+00
Psoriasis EA90 Skin 5.66E-30 4.24E-01 1.79E+00
Rectal cancer 2B92 Rectal colon tissue 1.94E-02 3.05E-01 1.45E+00
Renal cancer 2C90-2C91 Kidney 1.99E-02 2.27E-01 8.19E-01
Retinoblastoma 2D02.2 Uvea 2.70E-07 8.97E-01 3.86E+00
Rheumatoid arthritis FA20 Synovial tissue 8.32E-01 -1.75E-01 -5.15E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.27E-01 1.74E-02 1.38E-01
Schizophrenia 6A20 Prefrontal cortex 5.23E-01 2.11E-02 5.06E-02
Schizophrenia 6A20 Superior temporal cortex 1.00E+00 4.18E-03 4.49E-02
Scleroderma 4A42.Z Whole blood 6.35E-02 -7.92E-02 -4.14E-01
Seizure 8A60-8A6Z Whole blood 4.02E-01 2.35E-01 9.22E-01
Sensitive skin EK0Z Skin 5.82E-01 3.23E-02 3.33E-01
Sepsis with septic shock 1G41 Whole blood 3.24E-43 -3.26E-01 -1.39E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.47E-01 1.90E-02 5.87E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.56E-02 -8.12E-02 -5.11E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.83E-01 -2.92E-01 -1.61E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.43E-01 1.68E-01 8.99E-01
Skin cancer 2C30-2C3Z Skin 1.78E-19 2.68E-01 9.39E-01
Thrombocythemia 3B63 Whole blood 5.78E-05 -1.32E-01 -1.20E+00
Thrombocytopenia 3B64 Whole blood 1.19E-03 -3.96E-01 -1.46E+00
Thyroid cancer 2D10 Thyroid 4.31E-01 -4.77E-02 -2.60E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.25E-01 5.17E-02 2.53E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.48E-01 6.75E-02 3.40E-01
Type 2 diabetes 5A11 Liver tissue 3.75E-01 1.48E-02 8.10E-02
Ureter cancer 2C92 Urothelium 6.11E-01 2.81E-02 2.18E-01
Uterine cancer 2C78 Endometrium tissue 3.02E-24 4.89E-01 1.45E+00
Vitiligo ED63.0 Skin 9.38E-03 2.63E-01 1.50E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Orotidine 5'-monophosphate decarboxylase (UMPS) DTT Info
DME DTT Type Literature-reported
7 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
5-fluoro-6-amino-UMP DM6QHIA Discovery agent N.A. Investigative [1]
5-fluoro-6-azido-UMP DMZLJRS Discovery agent N.A. Investigative [1]
5-Fluoro-6-ethyluridine-5'-O-monophosphate DMTAZ71 Discovery agent N.A. Investigative [1]
5-fluoro-6-iodo-UMP DM3LMIS Discovery agent N.A. Investigative [1]
6-Hydroxyuridine-5'-Phosphate DMDMNQV Discovery agent N.A. Investigative [2]
Alpha-Phosphoribosylpyrophosphoric Acid DMT6KI7 Discovery agent N.A. Investigative [3]
Pyrazofurin DMVJLSM Discovery agent N.A. Investigative [4]
⏷ Show the Full List of 7 Investigative Drug(s)

References

1 Structure-activity relationships of orotidine-5'-monophosphate decarboxylase inhibitors as anticancer agents. J Med Chem. 2009 Mar 26;52(6):1648-58.
2 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
3 The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
4 Molecular approaches for the treatment of hemorrhagic fever virus infections. Antiviral Res. 1993 Sep;22(1):45-75.
5 Orotate phosphoribosyltransferase is overexpressed in malignant pleural mesothelioma: Dramatically responds one case in high OPRT expression. Rare Dis. 2016 Apr 5;4(1):e1165909.