Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEX9ZJQ)

DME Name Triokinase/FMN cyclase (TKFC)
Synonyms
ATP-dependent dihydroxyacetone kinase; FMN cyclase; Glycerone kinase; Triokinase; Triose kinase; DHA kinase; Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing); FAD-AMP lyase (cyclic FMN forming); FAD-AMP lyase (cyclizing); DAK; TKFC
Gene Name TKFC
UniProt ID
TKFC_HUMAN
INTEDE ID
DME0470
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
26007
EC Number EC: 4.6.1.15
Lyases
Phosphorus-oxygen lyase
Phosphorus-oxygen lyase
EC: 4.6.1.15
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVALLSGGGSGHE
PAHAGFIGKGMLTGVIAGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGL
AREQARAEGIPVEMVVIGDDSAFTVLKKAGRRGLCGTVLIHKVAGALAEAGVGLEEIAKQ
VNVVAKAMGTLGVSLSSCSVPGSKPTFELSADEVELGLGIHGEAGVRRIKMATADEIVKL
MLDHMTNTTNASHVPVQPGSSVVMMVNNLGGLSFLELGIIADATVRSLEGRGVKIARALV
GTFMSALEMPGISLTLLLVDEPLLKLIDAETTAAAWPNVAAVSITGRKRSRVAPAEPQEA
PDSTAAGGSASKRMALVLERVCSTLLGLEEHLNALDRAAGDGDCGTTHSRAARAIQEWLK
EGPPPASPAQLLSKLSVLLLEKMGGSSGALYGLFLTAAAQPLKAKTSLPAWSAAMDAGLE
AMQKYGKAAPGDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAAAEATKNMEAG
AGRASYISSARLEQPDPGAVAAAAILRAILEVLQS
Function This enzyme catalyzes both the phosphorylation of dihydroxyacetone and of glyceraldehyde, and the splitting of ribonucleoside diphosphate-X compounds among which FAD is the best substrate.
KEGG Pathway
Carbon metabolism (hsa01200 )
Fructose and mannose metabolism (hsa00051 )
Glycerolipid metabolism (hsa00561 )
Metabolic pathways (hsa01100 )
RIG-I-like receptor signaling pathway (hsa04622 )
Reactome Pathway
Fructose catabolism (R-HSA-70350 )
DDX58/IFIH1-mediated induction of interferon-alpha/beta (R-HSA-168928 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Dihydroxyacetone DMM1LG2 Sunburn EJ40 Approved [1]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
D-glyceraldehyde DMAYPLE N. A. N. A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Dihydroxyacetone Sunburn [EJ40] Approved Km = 0.0099 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.48E-21 2.50E-01 1.21E+00
Alopecia ED70 Skin from scalp 1.91E-01 1.07E-01 4.40E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.51E-08 -1.66E-01 -7.59E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.40E-01 1.63E-01 8.41E-01
Aortic stenosis BB70 Calcified aortic valve 4.81E-01 1.05E-01 3.64E-01
Apnea 7A40 Hyperplastic tonsil 5.26E-01 -7.96E-02 -3.79E-01
Arthropathy FA00-FA5Z Peripheral blood 8.63E-01 -2.79E-02 -2.81E-01
Asthma CA23 Nasal and bronchial airway 2.14E-03 2.99E-02 5.72E-02
Atopic dermatitis EA80 Skin 4.20E-03 5.42E-02 3.29E-01
Autism 6A02 Whole blood 3.70E-01 9.53E-03 7.72E-02
Autoimmune uveitis 9A96 Peripheral monocyte 5.01E-01 -2.60E-02 -1.41E-01
Autosomal dominant monocytopenia 4B04 Whole blood 8.72E-01 -1.74E-03 -1.73E-02
Bacterial infection of gingival 1C1H Gingival tissue 4.90E-02 5.27E-02 2.35E-01
Batten disease 5C56.1 Whole blood 2.09E-01 -6.29E-02 -4.50E-01
Behcet's disease 4A62 Peripheral blood 8.98E-02 -2.38E-01 -1.24E+00
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.85E-01 -2.55E-02 -1.43E-01
Bladder cancer 2C94 Bladder tissue 6.61E-01 -5.20E-02 -2.09E-01
Breast cancer 2C60-2C6Z Breast tissue 1.06E-05 7.84E-02 3.05E-01
Cardioembolic stroke 8B11.20 Whole blood 1.74E-08 -3.91E-01 -1.81E+00
Cervical cancer 2C77 Cervical tissue 8.78E-01 -4.77E-02 -3.38E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.24E-01 2.26E-02 1.22E-01
Chronic hepatitis C 1E51.1 Whole blood 4.30E-01 -2.84E-02 -1.83E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.77E-01 3.97E-02 2.59E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.49E-01 -7.61E-02 -2.87E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.07E-01 9.80E-02 7.57E-01
Colon cancer 2B90 Colon tissue 7.29E-01 2.87E-02 8.53E-02
Coronary artery disease BA80-BA8Z Peripheral blood 3.79E-02 -1.32E-01 -1.47E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.99E-01 8.57E-02 4.53E-01
Endometriosis GA10 Endometrium tissue 3.11E-03 -1.12E-01 -5.65E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.17E-01 8.73E-04 1.55E-02
Familial hypercholesterolemia 5C80.00 Whole blood 3.75E-03 2.52E-01 1.08E+00
Gastric cancer 2B72 Gastric tissue 9.53E-01 5.84E-02 1.23E-01
Glioblastopma 2A00.00 Nervous tissue 3.76E-02 3.11E-02 1.20E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.87E-01 -1.44E-02 -3.96E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.78E-03 -1.97E-01 -1.29E+00
Head and neck cancer 2D42 Head and neck tissue 2.10E-10 -2.84E-01 -8.00E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.85E-01 -4.90E-02 -3.78E-01
Huntington's disease 8A01.10 Whole blood 5.92E-01 1.29E-02 1.61E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.15E-01 8.34E-03 5.62E-02
Immunodeficiency 4A00-4A20 Peripheral blood 6.07E-01 -3.57E-03 -3.38E-02
Influenza 1E30 Whole blood 4.89E-01 2.86E-02 1.26E-01
Interstitial cystitis GC00.3 Bladder tissue 2.57E-02 -3.00E-01 -1.19E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.84E-01 -1.62E-01 -8.87E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.11E-01 -7.31E-02 -2.40E-01
Ischemic stroke 8B11 Peripheral blood 4.45E-01 -5.31E-02 -3.41E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.47E-03 -2.04E-01 -7.48E-01
Lateral sclerosis 8B60.4 Skin 4.11E-01 1.46E-01 8.86E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 4.38E-01 1.50E-02 1.30E-01
Liver cancer 2C12.0 Liver tissue 4.97E-07 -1.37E+00 -1.31E+00
Liver failure DB99.7-DB99.8 Liver tissue 7.64E-03 -5.59E-01 -1.53E+00
Lung cancer 2C25 Lung tissue 1.32E-02 -1.17E-01 -5.21E-01
Lupus erythematosus 4A40 Whole blood 4.12E-02 -3.99E-02 -1.13E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.69E-01 8.62E-02 4.93E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.62E-01 3.11E-02 1.13E-01
Melanoma 2C30 Skin 1.80E-02 -2.54E-01 -7.05E-01
Multiple myeloma 2A83.1 Peripheral blood 5.49E-01 -5.37E-02 -6.52E-01
Multiple myeloma 2A83.1 Bone marrow 2.57E-03 2.18E-01 1.53E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.14E-01 3.19E-02 1.54E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.35E-01 2.86E-02 8.83E-02
Myelofibrosis 2A20.2 Whole blood 7.37E-04 -1.31E-01 -1.03E+00
Myocardial infarction BA41-BA50 Peripheral blood 3.85E-01 -9.77E-02 -1.99E-01
Myopathy 8C70.6 Muscle tissue 7.39E-01 -1.94E-02 -1.42E-01
Neonatal sepsis KA60 Whole blood 2.06E-06 1.07E-01 6.06E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 7.51E-06 -5.00E-01 -2.90E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.10E-01 4.15E-01 5.06E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.24E-01 -2.83E-02 -2.23E-01
Olive pollen allergy CA08.00 Peripheral blood 3.39E-03 2.59E-01 2.67E+00
Oral cancer 2B6E Oral tissue 1.20E-01 -7.57E-02 -3.65E-01
Osteoarthritis FA00-FA0Z Synovial tissue 9.25E-01 -1.19E-01 -3.42E-01
Osteoporosis FB83.1 Bone marrow 3.39E-03 2.78E-01 2.66E+00
Ovarian cancer 2C73 Ovarian tissue 8.74E-01 5.78E-03 1.76E-02
Pancreatic cancer 2C10 Pancreas 1.40E-02 1.01E-01 3.17E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.52E-01 6.67E-02 5.71E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.86E-01 6.25E-02 5.07E-01
Pituitary cancer 2D12 Pituitary tissue 2.59E-01 3.20E-02 2.49E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.86E-01 -8.08E-02 -5.08E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.06E-01 -1.33E-02 -1.28E-01
Polycythemia vera 2A20.4 Whole blood 5.09E-05 -1.18E-01 -1.00E+00
Pompe disease 5C51.3 Biceps muscle 2.00E-01 1.13E-01 7.45E-01
Preterm birth KA21.4Z Myometrium 2.01E-02 2.26E-01 1.83E+00
Prostate cancer 2C82 Prostate 2.86E-02 -3.54E-01 -7.79E-01
Psoriasis EA90 Skin 2.64E-03 -7.55E-02 -3.10E-01
Rectal cancer 2B92 Rectal colon tissue 4.14E-02 -1.46E-01 -1.61E+00
Renal cancer 2C90-2C91 Kidney 2.65E-03 -8.98E-01 -1.56E+00
Retinoblastoma 2D02.2 Uvea 2.56E-01 1.78E-01 1.03E+00
Rheumatoid arthritis FA20 Synovial tissue 9.67E-01 4.21E-02 1.59E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.26E-01 -1.24E-03 -1.42E-02
Schizophrenia 6A20 Prefrontal cortex 6.62E-02 -3.93E-02 -1.91E-01
Schizophrenia 6A20 Superior temporal cortex 7.44E-01 3.72E-02 3.95E-01
Scleroderma 4A42.Z Whole blood 1.78E-04 -2.89E-01 -2.06E+00
Seizure 8A60-8A6Z Whole blood 7.30E-01 6.43E-02 2.77E-01
Sensitive skin EK0Z Skin 7.54E-02 -9.77E-02 -7.31E-01
Sepsis with septic shock 1G41 Whole blood 8.39E-08 9.64E-02 6.16E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.23E-02 -1.78E-02 -1.51E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.99E-01 1.20E-01 7.29E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.97E-01 7.24E-02 2.24E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.74E-01 -2.23E-01 -1.07E+00
Skin cancer 2C30-2C3Z Skin 7.86E-11 -1.72E-01 -6.25E-01
Thrombocythemia 3B63 Whole blood 3.23E-02 -1.04E-01 -8.13E-01
Thrombocytopenia 3B64 Whole blood 4.30E-01 3.22E-01 4.52E-01
Thyroid cancer 2D10 Thyroid 1.20E-12 -3.08E-01 -8.55E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.02E-01 -1.47E-01 -5.27E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.70E-01 -3.28E-01 -1.01E+00
Type 2 diabetes 5A11 Liver tissue 6.57E-01 -4.47E-02 -9.81E-02
Ureter cancer 2C92 Urothelium 7.02E-01 -3.78E-02 -3.94E-01
Uterine cancer 2C78 Endometrium tissue 4.36E-19 -3.42E-01 -9.41E-01
Vitiligo ED63.0 Skin 1.28E-01 -1.05E-01 -5.19E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Bifunctional homodimeric triokinase/FMN cyclase: contribution of protein domains to the activities of the human enzyme and molecular dynamics simulation of domain movements. J Biol Chem. 2014 Apr 11;289(15):10620-36.