Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEXZA9U)

DME Name Cytochrome P450 2A13 (CYP2A13)
Synonyms Cytochrome P450 family 2 subfamily A member 13; CYP2A13; CYPIIA13; CPAD; CYP2A
Gene Name CYP2A13
UniProt ID
CP2AD_HUMAN
INTEDE ID
DME0030
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1553
EC Number EC: 1.14.14.1
Oxidoreductase
Oxygen paired donor oxidoreductase
Flavin/flavoprotein donor oxidoreductase
EC: 1.14.14.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPPGPTPLPFIGNYLQLNTEQMYNSLMK
ISERYGPVFTIHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSN
GERAKQLRRFSIATLRGFGVGKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSN
VISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKE
LQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFF
AGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQ
RFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPRDFNPQHFLDKK
GQFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKDIDVSPKHVGF
ATIPRNYTMSFLPR
Function
This enzyme exhibits a coumarin 7-hydroxylase activity and is active in the metabolic activation of hexamethylphosphoramide, N,N-dimethylaniline, 2'-methoxyacetophenone, N-nitrosomethylphenylamine, and the tobacco- specific carcinogen, 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone. It possesses phenacetin O-deethylation activity.
KEGG Pathway
Chemical carcinogenesis (hsa05204 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Reactome Pathway
CYP2E1 reactions (R-HSA-211999 )
Fatty acids (R-HSA-211935 )
Xenobiotics (R-HSA-211981 )
Aflatoxin activation and detoxification (R-HSA-5423646 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
2 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Nicotine DMWX5CO Lung cancer 2C25.0 Approved [1]
Testosterone cypionate DMC1TEV N. A. N. A. Approved [2]
1 Discontinued Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Phenacetin DMRQAM0 Analgesia MB40.8 Withdrawn from market [3]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.13E-01 6.44E-02 2.99E-01
Alopecia ED70 Skin from scalp 5.96E-01 -5.31E-02 -2.41E-01
Alzheimer's disease 8A20 Entorhinal cortex 9.89E-01 -6.41E-03 -3.83E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 7.09E-01 3.77E-02 3.57E-01
Aortic stenosis BB70 Calcified aortic valve 8.23E-01 1.24E-01 1.48E-01
Apnea 7A40 Hyperplastic tonsil 7.42E-02 -4.57E-01 -6.15E+00
Arthropathy FA00-FA5Z Peripheral blood 2.01E-01 -9.30E-03 -4.54E-02
Asthma CA23 Nasal and bronchial airway 1.40E-01 3.03E-01 2.60E-01
Atopic dermatitis EA80 Skin 1.37E-01 3.83E-02 1.70E-01
Autism 6A02 Whole blood 3.38E-01 1.41E-02 4.48E-02
Autoimmune uveitis 9A96 Peripheral monocyte 2.29E-01 7.09E-02 1.26E+00
Autosomal dominant monocytopenia 4B04 Whole blood 7.41E-01 -2.45E-02 -1.87E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.17E-07 2.00E-01 7.93E-01
Batten disease 5C56.1 Whole blood 3.06E-01 8.53E-02 9.15E-01
Behcet's disease 4A62 Peripheral blood 3.61E-01 -1.02E-01 -3.89E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.06E-01 -5.39E-02 -3.11E-01
Bladder cancer 2C94 Bladder tissue 1.04E-01 2.42E-01 8.31E-01
Breast cancer 2C60-2C6Z Breast tissue 1.75E-08 -1.46E-01 -3.48E-01
Cardioembolic stroke 8B11.20 Whole blood 5.59E-02 1.67E-02 9.39E-02
Cervical cancer 2C77 Cervical tissue 7.09E-01 2.12E-02 8.31E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.94E-01 3.23E-02 1.34E-01
Chronic hepatitis C 1E51.1 Whole blood 8.07E-01 3.59E-02 3.09E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.21E-01 2.65E-02 8.62E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.72E-01 -9.88E-02 -2.27E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.52E-02 -2.91E-01 -6.64E-01
Colon cancer 2B90 Colon tissue 1.27E-23 -3.12E-01 -1.05E+00
Coronary artery disease BA80-BA8Z Peripheral blood 8.73E-01 7.89E-03 4.49E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.74E-01 -4.65E-02 -1.84E-01
Endometriosis GA10 Endometrium tissue 1.15E-02 7.19E-02 2.88E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.21E-03 2.41E-01 1.41E+00
Familial hypercholesterolemia 5C80.00 Whole blood 6.19E-01 5.85E-02 1.95E-01
Gastric cancer 2B72 Gastric tissue 4.42E-02 -2.24E-01 -2.74E+00
Glioblastopma 2A00.00 Nervous tissue 1.17E-52 -3.10E-01 -1.08E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 8.99E-01 -4.52E-02 -3.56E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.40E-01 6.33E-02 6.73E-01
Head and neck cancer 2D42 Head and neck tissue 6.83E-13 -3.09E-01 -7.25E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.32E-02 -1.34E-01 -5.34E-01
Huntington's disease 8A01.10 Whole blood 9.94E-01 8.68E-02 2.60E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.57E-01 -1.47E-01 -4.09E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.19E-01 1.01E-02 5.46E-02
Influenza 1E30 Whole blood 4.61E-03 7.17E-01 4.00E+00
Interstitial cystitis GC00.3 Bladder tissue 8.32E-01 4.33E-02 4.33E-01
Intracranial aneurysm 8B01.0 Intracranial artery 6.56E-01 6.07E-02 2.05E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.31E-01 -5.52E-02 -1.94E-01
Ischemic stroke 8B11 Peripheral blood 2.05E-01 6.08E-02 3.34E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.32E-02 1.36E-01 5.46E-01
Lateral sclerosis 8B60.4 Skin 1.13E-01 -1.26E-01 -1.17E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 8.13E-01 -2.22E-02 -5.85E-02
Liver cancer 2C12.0 Liver tissue 7.26E-07 -9.89E-01 -1.29E+00
Liver failure DB99.7-DB99.8 Liver tissue 3.60E-02 -4.76E-01 -1.37E+00
Lung cancer 2C25 Lung tissue 4.73E-01 1.95E-02 6.07E-02
Lupus erythematosus 4A40 Whole blood 7.46E-02 -1.50E-01 -1.97E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.77E-01 3.79E-02 2.41E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.16E-02 6.63E-02 3.28E-01
Melanoma 2C30 Skin 9.59E-01 6.53E-02 1.34E-01
Multiple myeloma 2A83.1 Peripheral blood 9.00E-01 3.84E-02 2.31E-01
Multiple myeloma 2A83.1 Bone marrow 3.30E-01 1.01E-01 2.76E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.14E-01 2.26E-01 6.76E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.28E-01 2.04E-02 9.26E-02
Myelofibrosis 2A20.2 Whole blood 4.58E-03 4.44E-01 1.93E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.11E-01 2.05E-01 5.00E-01
Myopathy 8C70.6 Muscle tissue 9.10E-02 -2.75E-01 -1.27E+00
Neonatal sepsis KA60 Whole blood 2.81E-03 6.55E-02 2.30E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.04E-02 -3.97E-01 -1.27E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.50E-02 -5.58E-02 -3.24E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.57E-01 -3.13E-02 -2.46E-01
Olive pollen allergy CA08.00 Peripheral blood 2.67E-01 1.33E-01 5.47E-01
Oral cancer 2B6E Oral tissue 5.20E-05 -4.77E-01 -1.04E+00
Osteoarthritis FA00-FA0Z Synovial tissue 9.87E-02 -7.13E-01 -1.20E+00
Osteoporosis FB83.1 Bone marrow 4.29E-02 4.02E-01 2.67E+00
Ovarian cancer 2C73 Ovarian tissue 2.01E-01 -9.02E-02 -4.19E-01
Pancreatic cancer 2C10 Pancreas 8.21E-02 -3.22E-01 -5.54E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.79E-01 4.03E-02 2.20E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.29E-01 1.95E-02 1.16E-01
Pituitary cancer 2D12 Pituitary tissue 3.59E-02 1.28E-01 4.36E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.61E-01 1.34E-01 4.18E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.38E-01 1.52E-02 9.41E-02
Polycythemia vera 2A20.4 Whole blood 2.96E-09 3.21E-01 1.40E+00
Pompe disease 5C51.3 Biceps muscle 9.04E-01 -1.83E-02 -1.30E-01
Preterm birth KA21.4Z Myometrium 4.36E-01 3.27E-02 1.18E-01
Prostate cancer 2C82 Prostate 3.42E-02 -5.15E-01 -8.59E-01
Psoriasis EA90 Skin 4.62E-10 -2.42E-01 -5.45E-01
Rectal cancer 2B92 Rectal colon tissue 1.63E-02 -2.09E-01 -8.32E-01
Renal cancer 2C90-2C91 Kidney 9.51E-03 -3.64E-01 -9.77E-01
Retinoblastoma 2D02.2 Uvea 4.57E-03 -3.20E-01 -1.76E+00
Rheumatoid arthritis FA20 Synovial tissue 1.75E-03 -1.54E+00 -2.43E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.21E-02 4.69E-02 8.40E-02
Schizophrenia 6A20 Prefrontal cortex 4.04E-01 -3.75E-02 -1.26E-01
Schizophrenia 6A20 Superior temporal cortex 8.64E-01 2.59E-02 1.89E-01
Scleroderma 4A42.Z Whole blood 2.82E-04 4.30E-01 2.29E+00
Seizure 8A60-8A6Z Whole blood 4.42E-02 -2.62E-01 -1.00E+00
Sensitive skin EK0Z Skin 8.86E-01 2.15E-02 1.17E-01
Sepsis with septic shock 1G41 Whole blood 3.08E-02 4.16E-02 1.39E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.21E-01 1.59E-01 5.98E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.55E-01 -7.15E-02 -1.57E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.85E-01 2.51E-02 6.07E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.11E-01 3.50E-02 2.63E-01
Skin cancer 2C30-2C3Z Skin 1.14E-09 -3.21E-01 -5.44E-01
Thrombocythemia 3B63 Whole blood 2.27E-02 1.83E-01 7.61E-01
Thrombocytopenia 3B64 Whole blood 5.81E-01 -5.43E-02 -2.59E-01
Thyroid cancer 2D10 Thyroid 7.41E-03 5.09E-02 2.25E-01
Tibial muscular dystrophy 8C75 Muscle tissue 5.15E-05 -3.15E-01 -1.80E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.44E-01 -8.96E-03 -1.01E-01
Type 2 diabetes 5A11 Liver tissue 9.48E-01 1.26E-01 4.66E-01
Ureter cancer 2C92 Urothelium 7.67E-01 1.36E-02 4.37E-02
Uterine cancer 2C78 Endometrium tissue 2.11E-12 2.84E-01 7.18E-01
Vitiligo ED63.0 Skin 9.70E-01 -2.88E-02 -1.83E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Inactivation of CYP2A6 and CYP2A13 during nicotine metabolism. J Pharmacol Exp Ther. 2006 Jan;316(1):295-303.
2 Effects of 8-methoxypsoralen on cytochrome P450 2A13. Carcinogenesis. 2005 Mar;26(3):621-9.
3 CYP2A13 metabolizes the substrates of human CYP1A2, phenacetin, and theophylline. Drug Metab Dispos. 2007 Mar;35(3):335-9.