Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT026AAA)

DOT Name Spermatogenesis-associated protein 3 (SPATA3)
Synonyms Testis and spermatogenesis cell-related protein 1; Testis spermatocyte apoptosis-related protein 1
Gene Name SPATA3
Related Disease
Malaria ( )
Obsolete male infertility with azoospermia or oligozoospermia due to single gene mutation ( )
UniProt ID
SPTA3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15662
Sequence
MKKVKKKRSEARRHRDSTSQHASSNSTSQQPSPESTPQQPSPESTPQQPSPESTPQHSSL
ETTSRQPAFQALPAPEIRRSSCCLLSPDANVKAAPQSRKAGPLIRAGPHSCSCATCPCSS
ACWRRLGLCHSRIFDVLLPRDWQMAPGRGLPNLLTFYRKSSRKPSSHRNACPPSPRNCGC
GSGGSRSCLLHH

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Malaria DISQ9Y50 Strong Genetic Variation [1]
Obsolete male infertility with azoospermia or oligozoospermia due to single gene mutation DIS56JR8 Moderate Autosomal recessive [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Spermatogenesis-associated protein 3 (SPATA3). [3]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Spermatogenesis-associated protein 3 (SPATA3). [4]
------------------------------------------------------------------------------------

References

1 Genome-wide and fine-resolution association analysis of malaria in West Africa.Nat Genet. 2009 Jun;41(6):657-65. doi: 10.1038/ng.388. Epub 2009 May 24.
2 A genomics approach to male infertility. Genet Med. 2020 Dec;22(12):1967-1975. doi: 10.1038/s41436-020-0916-0. Epub 2020 Jul 28.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.