Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT06NW7W)

DOT Name	Fibronectin type III domain-containing protein 10 (FNDC10)
Gene Name	FNDC10
UniProt ID	FND10_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF17742
Sequence	MRAPPLLLLLAACAPPPCAAAAPTPPGWEPTPDAPWCPYKVLPEGPEAGGGRLCFRSPAR GFRCQAPGCVLHAPAGRSLRASVLRNRSVLLQWRLAPAAARRVRAFALNCSWRGAYTRFP CERVLLGASCRDYLLPDVHDSVLYRLCLQPLPLRAGPAAAAPETPEPAECVEFTAEPAGM QDIVVAMTAVGGSICVMLVVICLLVAYITENLMRPALARPGLRRHP

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Fibronectin type III domain-containing protein 10 (FNDC10).	[1]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Fibronectin type III domain-containing protein 10 (FNDC10).	[2]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Fibronectin type III domain-containing protein 10 (FNDC10).	[3]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Fibronectin type III domain-containing protein 10 (FNDC10).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Fibronectin type III domain-containing protein 10 (FNDC10).	[5]
------------------------------------------------------------------------------------

References

1	Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
2	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
3	Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
4	Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
5	Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.