Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0F5B8C)

• DOT Name: Taste receptor type 2 member 20 (TAS2R20)
• Synonyms: Taste receptor type 2 member 49; T2R49; Taste receptor type 2 member 56; T2R56
• Gene Name: TAS2R20
• Related Disease: Craniosynostosis
• UniProt ID: T2R20_HUMAN
• Pfam ID: PF05296
• Sequence:
  MMSFLHIVFSILVVVAFILGNFANGFIALINFIAWVKRQKISSADQIIAALAVSRVGLLW
  VILLHWYSTVLNPTSSNLKVIIFISNAWAVTNHFSIWLATSLSIFYLLKIVNFSRLIFHH
  LKRKAKSVVLVIVLGSLFFLVCHLVMKHTYINVWTEECEGNVTWKIKLRNAMHLSNLTVA
  MLANLIPFTLTLISFLLLIYSLCKHLKKMQLHGKGSQDPSTKIHIKALQTVTSFLILLAI
  YFLCLIISFWNFKMRPKEIVLMLCQAFGIIYPSFHSFILIWGNKTLKQTFLSVLWQVTCW
  AKGQNQSTP
• Function: Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5.
• Tissue Specificity: Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells.
• KEGG Pathway: Taste transduction (hsa04742)
• Reactome Pathway:
  Class C/3 (Metabotropic glutamate/pheromone receptors) (R-HSA-420499)
  Sensory perception of sweet, bitter, and umami (glutamate) taste (R-HSA-9717207)
  G alpha (i) signalling events (R-HSA-418594)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Craniosynostosis	DIS6J405	Strong	Genetic Variation	[1]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Taste receptor type 2 member 20 (TAS2R20).	[2]
Permethrin	DMZ0Q1G	Approved	Permethrin increases the expression of Taste receptor type 2 member 20 (TAS2R20).	[3]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Taste receptor type 2 member 20 (TAS2R20).	[4]

References

• [1] Genetic variations in taste receptors are associated with chronic rhinosinusitis: a replication study.Int Forum Allergy Rhinol. 2014 Mar;4(3):200-6. doi: 10.1002/alr.21275. Epub 2014 Jan 10.
• [2] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
• [3] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [4] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.