Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0QCG1L)

DOT Name Histone H3.3C (H3-5)
Synonyms Histone H3.5
Gene Name H3-5
UniProt ID
H3C_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2PUY; 3KV4; 4Z5T; 5BWN; 5BWO; 5F6K; 5I3L; 6OI3; 7TRL; 7W67; 7W6I; 7W6J; 7W6L; 7Y0I; 7ZEZ
Pfam ID
PF00125
Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSTPSTCGVKPHRYRPGTVALREIRRYQKSTEL
LIRKLPFQRLVREIAQDFNTDLRFQSAAVGALQEASEAYLVGLLEDTNLCAIHAKRVTIM
PKDIQLARRIRGERA
Function
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Hominid-specific H3.5/H3F3C preferentially colocalizes with euchromatin, and it is associated with actively transcribed genes.
Tissue Specificity Specifically expressed in the seminiferous tubules of testis.
KEGG Pathway
Neutrophil extracellular trap formation (hsa04613 )
Alcoholism (hsa05034 )
Shigellosis (hsa05131 )
Transcriptio.l misregulation in cancer (hsa05202 )
Systemic lupus erythematosus (hsa05322 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin affects the expression of Histone H3.3C (H3-5). [1]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Histone H3.3C (H3-5). [2]
Milchsaure DM462BT Investigative Milchsaure affects the expression of Histone H3.3C (H3-5). [3]
------------------------------------------------------------------------------------

References

1 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
2 Poly(ADP-ribose) glycohydrolase silencing-mediated H2B expression inhibits benzo(a)pyrene-induced carcinogenesis. Environ Toxicol. 2021 Mar;36(3):291-297. doi: 10.1002/tox.23034. Epub 2020 Oct 12.
3 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.