Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2GLF5Z)

• DOT Name: Coiled-coil domain-containing protein 85A (CCDC85A)
• Gene Name: CCDC85A
• Related Disease:
  Breast cancer
  Breast carcinoma
• UniProt ID: CC85A_HUMAN
• Pfam ID: PF10226
• Sequence:
  MSKAAGGAAAAAAAAESCSPAPAGSSAAPPAPVEDLSKVSDEELLQWSKEELIRSLRRAE
  AEKVSAMLDHSNLIREVNRRLQLHLGEIRGLKDINQKLQEDNQELRDLCCFLDDDRQKGK
  RVSREWQRLGRYTAGVMHKEVALYLQKLKDLEVKQEEVVKENMELKELCVLLDEEKGAGC
  AGSRCSIDSQASLCQLTASTAPYVRDVGDGSSTSSTGSTDSPDHHKHHASSGSPEHLQKP
  RSEGSPEHSKHRSASPEHPQKPRACGTPDRPKALKGPSPEHHKPLCKGSPEQQRHPHPGS
  SPETLPKHVLSGSPEHFQKHRSGSSPEHARHSGGSPEHLQKHALGGSLEHLPRARGTSPE
  HLKQHYGGSPDHKHGGGSGGSGGSGGGSREGTLRRQAQEDGSPHHRNVYSGMNESTLSYV
  RQLEARVRQLEEENRMLPQASQNRRQPPTRNSSNMEKGWGSRARRVLQWWQGCRGIGRCL
  PTLPGSFRLSSGADGSNSSPNSAASFSGHATPSQQPEPVVHSLKVVWRKLGDAAGSCPGI
  RQHLSGNQYKGPM
• Function: May play a role in cell-cell adhesion and epithelium development through its interaction with proteins of the beta-catenin family.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Limited	Genetic Variation	[1]
Breast carcinoma	DIS2UE88	Limited	Genetic Variation	[1]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Coiled-coil domain-containing protein 85A (CCDC85A).	[2]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Coiled-coil domain-containing protein 85A (CCDC85A).	[3]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Coiled-coil domain-containing protein 85A (CCDC85A).	[3]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Coiled-coil domain-containing protein 85A (CCDC85A).	[4]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Coiled-coil domain-containing protein 85A (CCDC85A).	[6]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Coiled-coil domain-containing protein 85A (CCDC85A).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Coiled-coil domain-containing protein 85A (CCDC85A).	[5]

References

• [1] DDT exposure during pregnancy and DNA methylation alterations in female offspring in the Child Health and Development Study.Reprod Toxicol. 2020 Mar;92:138-147. doi: 10.1016/j.reprotox.2019.02.010. Epub 2019 Feb 26.
• [2] Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
• [3] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [4] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [7] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.