Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2OBSP0)

• DOT Name: Homeobox protein DBX2 (DBX2)
• Synonyms: Developing brain homeobox protein 2
• Gene Name: DBX2
• Related Disease:
  Hepatocellular carcinoma
  Neoplasm
  Intellectual disability
• UniProt ID: DBX2_HUMAN
• Pfam ID: PF00046
• Sequence:
  MLPSAVAAHAGAYWDVVASSALLNLPAAPGFGNLGKSFLIENLLRVGGAPTPRLQPPAPH
  DPATALATAGAQLRPLPASPVPLKLCPAAEQVSPAGAPYGTRWAFQVLSPSADSARLPGR
  APGDRDCTFQPSAPAPSKPFLLSTPPFYSACCGGSCRRPASSTAFPREESMLPLLTQDSN
  SKARRGILRRAVFSEDQRKALEKMFQKQKYISKTDRKKLAINLGLKESQVKIWFQNRRMK
  WRNSKEKEVLSNRCIQEVGLQEDPLSRSALGFPSPCPSIWDVPQQHSSPRWRENSPEPSE
  RLIQESSGAPPPEANSLQGALYLCSEEEAGSKGVLTGAV

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[1]
Neoplasm	DISZKGEW	Strong	Biomarker	[1]
Intellectual disability	DISMBNXP	Limited	Biomarker	[2]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Homeobox protein DBX2 (DBX2).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Homeobox protein DBX2 (DBX2).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Homeobox protein DBX2 (DBX2).	[5]

References

• [1] Dbx2 exhibits a tumor-promoting function in hepatocellular carcinoma cell lines via regulating Shh-Gli1 signaling.World J Gastroenterol. 2019 Feb 28;25(8):923-940. doi: 10.3748/wjg.v25.i8.923.
• [2] Haploinsufficiency of ANO6, NELL2 and DBX2 in a boy with intellectual disability and growth delay.Am J Med Genet A. 2015 Aug;167A(8):1890-6. doi: 10.1002/ajmg.a.37079. Epub 2015 Apr 6.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.