Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT35ZKLI)

• DOT Name: Small proline-rich protein 2G (SPRR2G)
• Synonyms: SPR-2G
• Gene Name: SPRR2G
• UniProt ID: SPR2G_HUMAN
• Pfam ID: PF14820
• Sequence:
  MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQP
  YPPCQQKYPPKSK
• Function: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
• Reactome Pathway: Formation of the cornified envelope (R-HSA-6809371)

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Small proline-rich protein 2G (SPRR2G).	[1]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Small proline-rich protein 2G (SPRR2G).	[1]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Small proline-rich protein 2G (SPRR2G).	[1]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Small proline-rich protein 2G (SPRR2G).	[2]

References

• [1] Retinoic acid and hydroquinone induce inverse expression patterns on cornified envelope-associated proteins: implication in skin irritation. J Dermatol Sci. 2014 Nov;76(2):112-9. doi: 10.1016/j.jdermsci.2014.08.003. Epub 2014 Aug 26.
• [2] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.