Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3EIK39)

DOT Name Transcription termination factor 1, mitochondrial (MTERF1)
Synonyms Mitochondrial transcription termination factor 1; mTERF; mTERF1
Gene Name MTERF1
Related Disease
Lung adenocarcinoma ( )
MELAS syndrome ( )
Mitochondrial disease ( )
Non-small-cell lung cancer ( )
Epithelial ovarian cancer ( )
UniProt ID
MTEF1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3MVA; 3MVB; 3N6S; 3N7Q; 5CKY; 5CO0; 5CRJ; 5CRK
Pfam ID
PF02536
Sequence
MQSLSLGQTSISKGLNYLTIMAPGNLWHMRNNFLFGSRCWMTRFSAENIFKSVSFRLFGV
KCHNTDSEPLKNEDLLKNLLTMGVDIDMARKRQPGVFHRMITNEQDLKMFLLSKGASKEV
IASIISRYPRAITRTPENLSKRWDLWRKIVTSDLEIVNILERSPESFFRSNNNLNLENNI
KFLYSVGLTRKCLCRLLTNAPRTFSNSLDLNKQMVEFLQAAGLSLGHNDPADFVRKIIFK
NPFILIQSTKRVKANIEFLRSTFNLNSEELLVLICGPGAEILDLSNDYARRSYANIKEKL
FSLGCTEEEVQKFVLSYPDVIFLAEKKFNDKIDCLMEENISISQIIENPRVLDSSISTLK
SRIKELVNAGCNLSTLNITLLSWSKKRYEAKLKKLSRFA
Function
Transcription termination factor. Binds to a 28 bp region within the tRNA(Leu(uur)) gene at a position immediately adjacent to and downstream of the 16S rRNA gene; this region comprises a tridecamer sequence critical for directing accurate termination. Binds DNA along the major grove and promotes DNA bending and partial unwinding. Promotes base flipping. Transcription termination activity appears to be polarized with highest specificity for transcripts initiated on the light strand.
Reactome Pathway
Transcriptional activation of mitochondrial biogenesis (R-HSA-2151201 )
Mitochondrial transcription termination (R-HSA-163316 )

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Lung adenocarcinoma DISD51WR Strong Altered Expression [1]
MELAS syndrome DIS81Z3S Strong Genetic Variation [2]
Mitochondrial disease DISKAHA3 Strong Biomarker [3]
Non-small-cell lung cancer DIS5Y6R9 Strong Altered Expression [1]
Epithelial ovarian cancer DIS56MH2 Limited Genetic Variation [4]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Transcription termination factor 1, mitochondrial (MTERF1). [5]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Transcription termination factor 1, mitochondrial (MTERF1). [6]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Transcription termination factor 1, mitochondrial (MTERF1). [7]
Folic acid DMEMBJC Approved Folic acid decreases the expression of Transcription termination factor 1, mitochondrial (MTERF1). [8]
Cannabidiol DM0659E Approved Cannabidiol increases the expression of Transcription termination factor 1, mitochondrial (MTERF1). [9]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of Transcription termination factor 1, mitochondrial (MTERF1). [10]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Transcription termination factor 1, mitochondrial (MTERF1). [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 Prognostic roles of mitochondrial transcription termination factors in non-small cell lung cancer.Oncol Lett. 2019 Oct;18(4):3453-3462. doi: 10.3892/ol.2019.10680. Epub 2019 Jul 29.
2 A novel point mutation in the mitochondrial tRNA(Leu)(UUR) gene in a family with mitochondrial myopathy.Ann Neurol. 1992 Jun;31(6):672-5. doi: 10.1002/ana.410310617.
3 Helix unwinding and base flipping enable human MTERF1 to terminate mitochondrial transcription.Cell. 2010 Jun 11;141(6):982-93. doi: 10.1016/j.cell.2010.05.018.
4 Inherited variants in mitochondrial biogenesis genes may influence epithelial ovarian cancer risk.Cancer Epidemiol Biomarkers Prev. 2011 Jun;20(6):1131-45. doi: 10.1158/1055-9965.EPI-10-1224. Epub 2011 Mar 29.
5 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
6 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
7 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
8 Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
9 Gingival Stromal Cells as an In Vitro Model: Cannabidiol Modulates Genes Linked With Amyotrophic Lateral Sclerosis. J Cell Biochem. 2017 Apr;118(4):819-828. doi: 10.1002/jcb.25757. Epub 2016 Nov 28.
10 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
11 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.