Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3NBPQO)

• DOT Name: Fibroblast growth factor-binding protein 2 (FGFBP2)
• Synonyms: FGF-BP2; FGF-binding protein 2; FGFBP-2; 37 kDa killer-specific secretory protein; Ksp37; HBp17-related protein; HBp17-RP
• Gene Name: FGFBP2
• Related Disease:
  Acute myocardial infarction
  Carcinoma
  Epstein barr virus infection
  Ovarian cancer
  Tuberculosis
• UniProt ID: FGFP2_HUMAN
• Pfam ID: PF06473
• Sequence:
  MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLR
  VDCRNTDQTYWCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREA
  GPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTR
  PTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFFRG
• Tissue Specificity: Expressed in serum, peripheral leukocytes and cytotoxic T-lymphocytes, but not in granulocytes and monocytes (at protein level).
• Reactome Pathway: FGFR2b ligand binding and activation (R-HSA-190377)

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute myocardial infarction	DISE3HTG	Strong	Biomarker	[1]
Carcinoma	DISH9F1N	Strong	Altered Expression	[2]
Epstein barr virus infection	DISOO0WT	Strong	Genetic Variation	[3]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[2]
Tuberculosis	DIS2YIMD	Disputed	Biomarker	[4]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Clozapine	DMFC71L	Approved	Clozapine increases the expression of Fibroblast growth factor-binding protein 2 (FGFBP2).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Fibroblast growth factor-binding protein 2 (FGFBP2).	[6]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Fibroblast growth factor-binding protein 2 (FGFBP2).	[7]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Fibroblast growth factor-binding protein 2 (FGFBP2).	[8]

References

• [1] Potential biomarkers of acute myocardial infarction based on weighted gene co-expression network analysis.Biomed Eng Online. 2019 Jan 25;18(1):9. doi: 10.1186/s12938-019-0625-6.
• [2] POLD2 and KSP37 (FGFBP2) correlate strongly with histology, stage and outcome in ovarian carcinomas.PLoS One. 2010 Nov 4;5(11):e13837. doi: 10.1371/journal.pone.0013837.
• [3] Killer-specific secretory (Ksp37) gene expression in subjects with Down's syndrome.Neurol Sci. 2016 May;37(5):793-5. doi: 10.1007/s10072-016-2554-5. Epub 2016 Mar 31.
• [4] The study of novel DNA vaccines against tuberculosis: induction of pathogen-specific CTL in the mouse and monkey models of tuberculosis.Hum Vaccin Immunother. 2013 Mar;9(3):515-25. doi: 10.4161/hv.23229. Epub 2012 Dec 18.
• [5] Histamine H4 receptor agonists have more activities than H4 agonism in antigen-specific human T-cell responses. Immunology. 2007 Jun;121(2):266-75. doi: 10.1111/j.1365-2567.2007.02574.x. Epub 2007 Mar 7.
• [6] Genome-wide transcriptional and functional analysis of human T lymphocytes treated with benzo[alpha]pyrene. Int J Mol Sci. 2018 Nov 17;19(11).
• [7] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [8] Comparison of transcriptome expression alterations by chronic exposure to low-dose bisphenol A in different subtypes of breast cancer cells. Toxicol Appl Pharmacol. 2019 Dec 15;385:114814. doi: 10.1016/j.taap.2019.114814. Epub 2019 Nov 9.