Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT47KUOO)

DOT Name	Protein kish-A (TMEM167A)
Synonyms	Transmembrane protein 167; Transmembrane protein 167A
Gene Name	TMEM167A
Related Disease	Neonatal diabetes mellitus ( )
UniProt ID	KISHA_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF06842
Sequence	MSAIFNFQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYVAVC CIVMAFSILFIQ
Function	Involved in the early part of the secretory pathway.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Neonatal diabetes mellitus	DISFHF9K	Limited	Autosomal recessive	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Protein kish-A (TMEM167A).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Protein kish-A (TMEM167A).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Protein kish-A (TMEM167A).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Protein kish-A (TMEM167A).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Protein kish-A (TMEM167A).	[6]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Protein kish-A (TMEM167A).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Protein kish-A (TMEM167A).	[8]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Protein kish-A (TMEM167A).	[9]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Drug(s)

References

1	Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
2	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3	Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
4	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
7	Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
8	Genome-wide transcriptional and functional analysis of human T lymphocytes treated with benzo[alpha]pyrene. Int J Mol Sci. 2018 Nov 17;19(11).
9	Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.