Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4ADXDN)

DOT Name	Protein PIGBOS1 (PIGBOS1)
Synonyms	PIGB opposite strand protein 1
Gene Name	PIGBOS1
UniProt ID	PIOS1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MFRRLTFAQLLFATVLGIAGGVYIFQPVFEQYAKDQKELKEKMQLVQESEEKKS
Function	Plays a role in regulation of the unfolded protein response triggered by endoplasmic reticulum (ER) stress resulting from the presence of unfolded proteins in the ER lumen.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Protein PIGBOS1 (PIGBOS1).	[1]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Protein PIGBOS1 (PIGBOS1).	[2]
------------------------------------------------------------------------------------

References

1	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
2	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.