Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4X45JZ)

• DOT Name: Membrane-spanning 4-domains subfamily A member 7 (MS4A7)
• Synonyms: CD20 antigen-like 4; CD20/FC-epsilon-RI-beta family member 4; Four-span transmembrane protein 2
• Gene Name: MS4A7
• UniProt ID: MS4A7_HUMAN
• Pfam ID: PF04103
• Sequence:
  MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLIS
  SLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTS
  NAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVS
  LTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI
• Function: May be involved in signal transduction as a component of a multimeric receptor complex.
• Tissue Specificity: Ubiquitous expression in normal tissues. Expression is more elevated in adult liver, lung, spleen, and heart than in their fetal counterparts, and is higher in normal tissues than in the cancerous tissue or cell lines. Low levels of expression were detected in the promonocytic stage, whereas high levels of expression were detected in mature monocytes.

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Membrane-spanning 4-domains subfamily A member 7 (MS4A7).	[1]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Membrane-spanning 4-domains subfamily A member 7 (MS4A7).	[2]
Pioglitazone	DMKJ485	Approved	Pioglitazone increases the expression of Membrane-spanning 4-domains subfamily A member 7 (MS4A7).	[3]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of Membrane-spanning 4-domains subfamily A member 7 (MS4A7).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Membrane-spanning 4-domains subfamily A member 7 (MS4A7).	[5]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Membrane-spanning 4-domains subfamily A member 7 (MS4A7).	[6]
Eugenol	DM7US1H	Patented	Eugenol increases the expression of Membrane-spanning 4-domains subfamily A member 7 (MS4A7).	[4]
Microcystin-LR	DMTMLRN	Investigative	Microcystin-LR decreases the expression of Membrane-spanning 4-domains subfamily A member 7 (MS4A7).	[7]

References

• [1] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [2] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [3] Peroxisome proliferator activated receptor gamma (PPAR-gama) ligand pioglitazone regulated gene networks in term human primary trophoblast cells. Reprod Toxicol. 2018 Oct;81:99-107.
• [4] Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
• [5] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [6] Highly active combination of BRD4 antagonist and histone deacetylase inhibitor against human acute myelogenous leukemia cells. Mol Cancer Ther. 2014 May;13(5):1142-54.
• [7] Gene expression network regulated by DNA methylation and microRNA during microcystin-leucine arginine induced malignant transformation in human hepatocyte L02 cells. Toxicol Lett. 2018 Jun 1;289:42-53. doi: 10.1016/j.toxlet.2018.03.003. Epub 2018 Mar 5.