Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4X4HHV)

DOT Name Histone H2B type F-M (H2BW2)
Synonyms Histone H2B.s; H2B/s
Gene Name H2BW2
Related Disease
Childhood acute lymphoblastic leukemia ( )
UniProt ID
H2BFM_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00125
Sequence
MAAASAMAEASSETTSEEGQSIQEPKEANSTKAQKQKRRGCRGSRRRHANRRGDSFGDSF
TPYFPRVLKQVHQGLSLSQEAVSVMDSMIHDILDRIATEAGQLAHYTKRVTITSRDIQMA
VRLLLPGKMGKLAEAQGTNAALRTSLCAIWQQRK
Function
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
KEGG Pathway
Neutrophil extracellular trap formation (hsa04613 )
Alcoholism (hsa05034 )
Viral carcinogenesis (hsa05203 )
Systemic lupus erythematosus (hsa05322 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Childhood acute lymphoblastic leukemia DISJ5D6U Strong Altered Expression [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Histone H2B type F-M (H2BW2). [2]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Berberine DMC5Q8X Phase 4 Berberine decreases the expression of Histone H2B type F-M (H2BW2). [3]
------------------------------------------------------------------------------------

References

1 Novel potential ALL low-risk markers revealed by gene expression profiling with new high-throughput SSH-CCS-PCR.Leukemia. 2003 Sep;17(9):1891-900. doi: 10.1038/sj.leu.2403073.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Berberine acts as a putative epigenetic modulator by affecting the histone code. Toxicol In Vitro. 2016 Oct;36:10-17. doi: 10.1016/j.tiv.2016.06.004. Epub 2016 Jun 13.