Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT57WPMB)

• DOT Name: LHFPL tetraspan subfamily member 4 protein (LHFPL4)
• Synonyms: GABAA receptor regulatory Lhfpl4; Lipoma HMGIC fusion partner-like 4 protein
• Gene Name: LHFPL4
• Related Disease:
  Advanced cancer
  Cervical cancer
  Cervical carcinoma
• UniProt ID: LHPL4_HUMAN
• Pfam ID: PF10242
• Sequence:
  MLPSQEASKLYHEHYMRNSRAIGVLWAIFTICFAIINVVVFIQPYWVGDSVSTPKPGYFG
  LFHYCVGSGLAGRELTCRGSFTDFSTIPSSAFKAAAFFVLLSMVLILGCITCFSLFFFCN
  TATVYKICAWMQLLAALCLVLGCMIFPDGWDAETIRDMCGAKTGKYSLGDCSVRWAYILA
  IIGILNALILSFLAFVLGNRQTDLLQEELKPENKDFVGSTVSSVLRPGGDVSGWGVLPCP
  VAHSQGP
• Function: Plays a role in the regulation of inhibitory synapse formation and function by being involved in maintening gamma-aminobutyric acid receptors (GABAARs) clustering and their associated scaffold proteins at inhibitory synaptic sites. Acts in concert with NLGN2 to recruit or stabilize GABAARs.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Posttranslational Modification	[1]
Cervical cancer	DISFSHPF	Strong	Posttranslational Modification	[1]
Cervical carcinoma	DIST4S00	Strong	Posttranslational Modification	[1]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of LHFPL tetraspan subfamily member 4 protein (LHFPL4).	[2]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of LHFPL tetraspan subfamily member 4 protein (LHFPL4).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of LHFPL tetraspan subfamily member 4 protein (LHFPL4).	[4]

References

• [1] Identification of novel methylation markers in cervical cancer using restriction landmark genomic scanning.Cancer Res. 2008 Apr 1;68(7):2489-97. doi: 10.1158/0008-5472.CAN-07-3194.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.