Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT66UEFP)

• DOT Name: Protein SPMIP9 (SPMIP9)
• Synonyms: Sperm microtubule inner protein 9; Testis-expressed sequence 37 protein; Testis-specific conserved protein of 21 kDa
• Gene Name: SPMIP9
• UniProt ID: SMIP9_HUMAN
• Pfam ID: PF15217
• Sequence:
  MAGVKYPGQDPVDLDIYQSSHMVDYQPYRKHKYSRVTPQEQAKLDAQLRDKEFYRPIPNP
  NPKLTDGYPAFKRPHMTAKDLGLPGFFPSQEHEATREDERKFTSTCHFTYPASHDLHLAQ
  GDPNQVLQSADFPCLVDPKHQPAAEMAKGYLLLPGCPCLHCHIVKVPILNRWGPLMPFYQ
• Tissue Specificity: Testis-specific . Detected in the germ cell lineage at all stages .

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Protein SPMIP9 (SPMIP9).	[1]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Protein SPMIP9 (SPMIP9).	[2]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Protein SPMIP9 (SPMIP9).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Protein SPMIP9 (SPMIP9).	[4]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [3] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [4] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.