Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT72PHSG)

• DOT Name: Male-enhanced antigen 1 (MEA1)
• Synonyms: MEA-1
• Gene Name: MEA1
• Related Disease:
  Maple syrup urine disease
  Medullary thyroid gland carcinoma
  Multiple endocrine neoplasia
• UniProt ID: MEA1_HUMAN
• Pfam ID: PF06910
• Sequence:
  MGPERHLSGAPARMATVVLGGDTMGPERIFPNQTEELGHQGPSEGTGDWSSEEPEEEQEE
  TGSGPAGYSYQPLNQDPEQEEVELAPVGDGDVVADIQDRIQALGLHLPDPPLESEDEDEE
  GATALNNHSSIPMDPEHVELVKRTMAGVSLPAPGVPAWAREISDAQWEDVVQKALQARQA
  SPAWK
• Function: May play an important role in spermatogenesis and/or testis development.
• Tissue Specificity: Highly expressed in testis.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Maple syrup urine disease	DIS61XRH	Strong	Biomarker	[1]
Medullary thyroid gland carcinoma	DISHBL3K	Strong	Genetic Variation	[2]
Multiple endocrine neoplasia	DISZGBKW	Strong	Genetic Variation	[2]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Male-enhanced antigen 1 (MEA1).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Male-enhanced antigen 1 (MEA1).	[4]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Male-enhanced antigen 1 (MEA1).	[5]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Male-enhanced antigen 1 (MEA1).	[6]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Male-enhanced antigen 1 (MEA1).	[7]

References

• [1] Maple syrup urine disease hair reveals the importance of 18-methyleicosanoic acid in cuticular delamination.Micron. 2005;36(3):261-6. doi: 10.1016/j.micron.2004.11.004. Epub 2005 Jan 25.
• [2] Multiple endocrine neoplasia type 2b in twins.Histopathology. 1982 Jan;6(1):111-9. doi: 10.1111/j.1365-2559.1982.tb02706.x.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [6] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [7] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.