Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7NE1ID)

• DOT Name: Putative transmembrane protein 244 (TMEM244)
• Gene Name: TMEM244
• UniProt ID: TM244_HUMAN
• Sequence:
  MALQVRVAPSKVVLQKFLLCVILFYTVYYVSLSMGCVMFEVHELNVLAPFDFKTNPSWLN
  INYKVLLVSTEVTYFVCGLFFVPVVEEWVWDYAISVTILHVAITSTVMLEFPLTSHWWAA
  LGISKLLV

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Putative transmembrane protein 244 (TMEM244).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Putative transmembrane protein 244 (TMEM244).	[3]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Putative transmembrane protein 244 (TMEM244).	[2]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Putative transmembrane protein 244 (TMEM244).	[4]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [4] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.