Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7YU4HK)

• DOT Name: Armadillo repeat-containing protein 10 (ARMC10)
• Synonyms: Splicing variant involved in hepatocarcinogenesis protein
• Gene Name: ARMC10
• Related Disease:
  Hepatocellular carcinoma
  Nervous system disease
• UniProt ID: ARM10_HUMAN
• Pfam ID: PF04826
• Sequence:
  MGGPRGAGWVAAGLLLGAGACYCIYRLTRGRRRGDRELGIRSSKSAGALEEGTSEGQLCG
  RSARPQTGGTWESQWSKTSQPEDLTDGSYDDVLNAEQLQKLLYLLESTEDPVIIERALIT
  LGNNAAFSVNQAIIRELGGIPIVANKINHSNQSIKEKALNALNNLSVNVENQIKIKIYIS
  QVCEDVFSGPLNSAVQLAGLTLLTNMTVTNDHQHMLHSYITDLFQVLLTGNGNTKVQVLK
  LLLNLSENPAMTEGLLRAQVDSSFLSLYDSHVAKEILLRVLTLFQNIKNCLKIEGHLAVQ
  PTFTEGSLFFLLHGEECAQKIRALVDHHDAEVKEKVVTIIPKI
• Function: May play a role in cell survival and cell growth. May suppress the transcriptional activity of p53/TP53.
• Tissue Specificity: Expressed in all tissues tested with higher expression in placenta, liver, kidney, heart and brain.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[1]
Nervous system disease	DISJ7GGT	Disputed	Altered Expression	[2]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Armadillo repeat-containing protein 10 (ARMC10).	[3]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Armadillo repeat-containing protein 10 (ARMC10).	[4]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Armadillo repeat-containing protein 10 (ARMC10).	[5]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Armadillo repeat-containing protein 10 (ARMC10).	[6]

References

• [1] A specific splicing variant of SVH, a novel human armadillo repeat protein, is up-regulated in hepatocellular carcinomas.Cancer Res. 2003 Jul 1;63(13):3775-82.
• [2] Dynamic expression analysis of armc10, the homologous gene of human GPRASP2, in zebrafish embryos.Mol Med Rep. 2017 Nov;16(5):5931-5937. doi: 10.3892/mmr.2017.7357. Epub 2017 Aug 24.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [5] Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
• [6] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.