Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8GLHGQ)

• DOT Name: Proline-rich protein 29 (PRR29)
• Gene Name: PRR29
• UniProt ID: PRR29_HUMAN
• Pfam ID: PF15248
• Sequence:
  MASGAGGSWGRSPPQSAVPTPWVTFLQPLSWAVPPAPPQPGRVKEDLLELMMLQNAQMHQ
  LLLSRLVAGALQPRPASPCPQVYLEVPQEEPEEEEEEMDVREKGPLVFHHHYLPYLMPSP
  GALLPWPAPFFPTPACQPYLQDVPRIQHCPASREREVRAVPPPPPPSATGTVGADVPPAS
  DYYDAESLL

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Proline-rich protein 29 (PRR29).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Proline-rich protein 29 (PRR29).	[3]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Proline-rich protein 29 (PRR29).	[2]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Proline-rich protein 29 (PRR29).	[4]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [4] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.