Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8OTY3E)

DOT Name Acyl-CoA wax alcohol acyltransferase 1 (AWAT1)
Synonyms EC 2.3.1.75; Diacylglycerol O-acyltransferase 2-like protein 3; Diacylglycerol acyltransferase 2; Long-chain-alcohol O-fatty-acyltransferase 1
Gene Name AWAT1
Related Disease
Hepatocellular carcinoma ( )
Fatty liver disease ( )
Neoplasm ( )
Non-alcoholic steatohepatitis ( )
UniProt ID
AWAT1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
2.3.1.75
Pfam ID
PF03982
Sequence
MAHSKQPSHFQSLMLLQWPLSYLAIFWILQPLFVYLLFTSLWPLPVLYFAWLFLDWKTPE
RGGRRSAWVRNWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA
TGFSKTFPGITPHLATLSWFFKIPFVREYLMAKGVCSVSQPAINYLLSHGTGNLVGIVVG
GVGEALQSVPNTTTLILQKRKGFVRTALQHGAHLVPTFTFGETEVYDQVLFHKDSRMYKF
QSCFRRIFGFYCCVFYGQSFCQGSTGLLPYSRPIVTVVGEPLPLPQIEKPSQEMVDKYHA
LYMDALHKLFDQHKTHYGCSETQKLFFL
Function
Acyltransferase that catalyzes the formation of ester bonds between fatty alcohols and fatty acyl-CoAs to form wax monoesters. Shows a strong preference for decyl alcohol (C10), with less activity towards C16 and C18 alcohols. Shows a strong preference for saturated acyl-CoAs.
Tissue Specificity
Predominantly expressed in skin, where it is limited to the sebaceous gland. Expressed in more mature, centrally located cells just before their rupture and sebum release. Also expressed in all tissues except spleen. Expressed at higher level in thymus, prostate and testis.
Reactome Pathway
Wax biosynthesis (R-HSA-9640463 )
Arachidonic acid metabolism (R-HSA-2142753 )

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Hepatocellular carcinoma DIS0J828 Definitive Altered Expression [1]
Fatty liver disease DIS485QZ Strong Biomarker [2]
Neoplasm DISZKGEW Strong Altered Expression [3]
Non-alcoholic steatohepatitis DIST4788 Limited Biomarker [4]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Acyl-CoA wax alcohol acyltransferase 1 (AWAT1). [5]
------------------------------------------------------------------------------------

References

1 Dgat2 reduces hepatocellular carcinoma malignancy via downregulation of cell cycle-related gene expression.Biomed Pharmacother. 2019 Jul;115:108950. doi: 10.1016/j.biopha.2019.108950. Epub 2019 May 8.
2 Trivalent Chromium Supplementation Ameliorates Oleic Acid-Induced Hepatic Steatosis in Mice.Biol Trace Elem Res. 2019 Jan;187(1):192-201. doi: 10.1007/s12011-018-1368-0. Epub 2018 May 24.
3 Intracellular mechanisms underlying lipid accumulation (white opaque substance) in gastric epithelial neoplasms: A pilot study of expression profiles of lipid-metabolism-associated genes.J Gastroenterol Hepatol. 2016 Apr;31(4):776-81. doi: 10.1111/jgh.13216.
4 Targeting diacylglycerol acyltransferase 2 for the treatment of nonalcoholic steatohepatitis.Sci Transl Med. 2019 Nov 27;11(520):eaav9701. doi: 10.1126/scitranslmed.aav9701.
5 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.