Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT90ZLHE)

• DOT Name: Tetratricopeptide repeat protein 36 (TTC36)
• Synonyms: TPR repeat protein 36; HSP70-binding protein 21
• Gene Name: TTC36
• Related Disease:
  Breast cancer
  Breast carcinoma
  Hepatocellular carcinoma
  Neoplasm
  Proliferative vitreoretinopathy
  Nervous system disease
  Tyrosinemia
• UniProt ID: TTC36_HUMAN
• Pfam ID: PF13424
• Sequence:
  MGTPNDQAVLQAIFNPDTPFGDIVGLDLGEEAEKEEREEDEVFPQAQLEQSKALELQGVM
  AAEAGDLSTALERFGQAICLLPERASAYNNRAQARRLQGDVAGALEDLERAVELSGGRGR
  AARQSFVQRGLLARLQGRDDDARRDFERAARLGSPFARRQLVLLNPYAALCNRMLADMMG
  QLRRPRDSR

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Strong	Altered Expression	[1]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[1]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[2]
Neoplasm	DISZKGEW	Strong	Biomarker	[3]
Proliferative vitreoretinopathy	DISZTEK1	Strong	Biomarker	[1]
Nervous system disease	DISJ7GGT	Limited	Altered Expression	[4]
Tyrosinemia	DISI8Q9Q	Limited	Altered Expression	[4]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Tetratricopeptide repeat protein 36 (TTC36).	[5]

References

• [1] HBP21: a novel member of TPR motif family, as a potential chaperone of heat shock protein 70 in proliferative vitreoretinopathy (PVR) and breast cancer.Mol Biotechnol. 2008 Nov;40(3):231-40. doi: 10.1007/s12033-008-9080-5. Epub 2008 Jun 29.
• [2] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [3] HBP21, a chaperone of heat shock protein 70, functions as a tumor suppressor in hepatocellular carcinoma.Carcinogenesis. 2015 Oct;36(10):1111-20. doi: 10.1093/carcin/bgv116. Epub 2015 Aug 5.
• [4] HPD degradation regulated by the TTC36-STK33-PELI1 signaling axis induces tyrosinemia and neurological damage.Nat Commun. 2019 Sep 19;10(1):4266. doi: 10.1038/s41467-019-12011-0.
• [5] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.