Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAXICYD)

• DOT Name: Cysteine-rich hydrophobic domain-containing protein 1 (CHIC1)
• Synonyms: Brain X-linked protein
• Gene Name: CHIC1
• Related Disease: Ovarian cancer
• UniProt ID: CHIC1_HUMAN
• Pfam ID: PF10256
• Sequence:
  MSILLPNMAEFDTISELEEEEEEEAATSSSSPSSSSSVSGPDDDEEDEEEEEEEEEEEEE
  EEEEEEEEAPPPPRVVSEEHLRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAP
  EEFKTSIGRVNACLKKALPVNVKWLLCGCLCCCCTLGCSLWPVICLNKRTRRSIQKLIEW
  ENNRLYHKLALHWKLTKRKCETSNMMEYVILIEFLPKYPIFRPD
• Tissue Specificity: Equally expressed in various parts of the brain.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Ovarian cancer	DISZJHAP	Strong	Biomarker	[1]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Cysteine-rich hydrophobic domain-containing protein 1 (CHIC1).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Cysteine-rich hydrophobic domain-containing protein 1 (CHIC1).	[3]
Clorgyline	DMCEUJD	Approved	Clorgyline increases the expression of Cysteine-rich hydrophobic domain-containing protein 1 (CHIC1).	[4]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Cysteine-rich hydrophobic domain-containing protein 1 (CHIC1).	[5]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Cysteine-rich hydrophobic domain-containing protein 1 (CHIC1).	[6]
Glyphosate	DM0AFY7	Investigative	Glyphosate decreases the expression of Cysteine-rich hydrophobic domain-containing protein 1 (CHIC1).	[7]

References

• [1] Expression of brx proto-oncogene in normal ovary and in epithelial ovarian neoplasms.Am J Obstet Gynecol. 2000 Feb;182(2):286-95. doi: 10.1016/s0002-9378(00)70213-4.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Anti-oncogenic and pro-differentiation effects of clorgyline, a monoamine oxidase A inhibitor, on high grade prostate cancer cells. BMC Med Genomics. 2009 Aug 20;2:55. doi: 10.1186/1755-8794-2-55.
• [5] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [6] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [7] Evaluation of estrogen receptor alpha activation by glyphosate-based herbicide constituents. Food Chem Toxicol. 2017 Oct;108(Pt A):30-42.