Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBMBD7I)

DOT Name	BPI fold-containing family C protein (BPIFC)
Synonyms	Bactericidal/permeability-increasing protein-like 2; BPI-like 2
Gene Name	BPIFC
Related Disease	Epithelial ovarian cancer ( ) Trichilemmal cyst ( )
UniProt ID	BPIFC_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF01273 ; PF02886
Sequence	MCTKTIPVLWGCFLLWNLYVSSSQTIYPGIKARITQRALDYGVQAGMKMIEQMLKEKKLP DLSGSESLEFLKVDYVNYNFSNIKISAFSFPNTSLAFVPGVGIKALTNHGTANISTDWGF ESPLFQDTGGADLFLSGVYFTGIIILTRNDFGHPTLKLQDCYAQLSHAHVSFSGELSVLY NSFAEPMEKPILKNLNEMLCPIIASEVKALNANLSTLEVLTKIDNYTLLDYSLISSPEIT ENYLDLNLKGVFYPLENLTDPPFSPVPFVLPERSNSMLYIGIAEYFFKSASFAHFTAGVF NVTLSTEEISNHFVQNSQGLGNVLSRIAEIYILSQPFMVRIMATEPPIINLQPGNFTLDI PASIMMLTQPKNSTVETIVSMDFVASTSVGLVILGQRLVCSLSLNRFRLALPESNRSNIE VLRFENILSSILHFGVLPLANAKLQQGFPLSNPHKFLFVNSDIEVLEGFLLISTDLKYET SSKQQPSFHVWEGLNLISRQWRGKSAP
Tissue Specificity	Detected in the basal layer of the epidermis from inflammatory skin from psoriasis patients, but not in normal skin.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Epithelial ovarian cancer	DIS56MH2	Limited	Genetic Variation	[1]
Trichilemmal cyst	DISLWEDU	Limited	Autosomal dominant	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of BPI fold-containing family C protein (BPIFC).	[3]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of BPI fold-containing family C protein (BPIFC).	[5]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of BPI fold-containing family C protein (BPIFC).	[4]
------------------------------------------------------------------------------------

References

1	Genome-wide association study of subtype-specific epithelial ovarian cancer risk alleles using pooled DNA.Hum Genet. 2014 May;133(5):481-97. doi: 10.1007/s00439-013-1383-3. Epub 2013 Nov 5.
2	Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
3	Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
4	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
5	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.