Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBMMY9Z)

• DOT Name: Ret finger protein-like 3 (RFPL3)
• Gene Name: RFPL3
• Related Disease: Non-small-cell lung cancer
• UniProt ID: RFPL3_HUMAN
• Pfam ID: PF13765 ; PF11002 ; PF00622 ; PF15227
• Sequence:
  MKRLSLVTTNRLSPQGNFLPLCTFPLAVDMAALFQEASSCPVCSDYLEKPMSLECGCTVC
  LKCINSLQKEPHGEDLLCCCCSMVSQRNKIRPNRQLERLVSHIKELEPKLKKILQMNPRM
  RKFQVDMTLDADTANNFLLISDDLRSVRSGLITQNRQDLAERFDVSVCILGSPRFTCGRH
  YWEVDVGTSTEWDLGVCRESVHCKGKIQLTTELGFWTVSLRDGSRLSASTVPLTFLLVDR
  KLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSICP
  LMNSGTTDAPVRPGEAK
• Function: (Microbial infection) Stimulates the activity of Human Immunodeficiency Virus 1/HIV-1 pre-integration complex.
• Tissue Specificity: Expressed during neurogenesis in differentiating human embryonic stem cells and in the developing human neocortex.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Ret finger protein-like 3 (RFPL3).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Ret finger protein-like 3 (RFPL3).	[3]

References

• [1] EGF upregulates RFPL3 and hTERT via the MEK signaling pathway in nonsmall cell lung cancer cells.Oncol Rep. 2018 Jul;40(1):29-38. doi: 10.3892/or.2018.6417. Epub 2018 May 8.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.