Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBX12V9)

DOT Name	TRAF-interacting protein with FHA domain-containing protein B (TIFAB)
Synonyms	TIFA-like protein
Gene Name	TIFAB
Related Disease	Aural atresia, congenital ( ) Childhood myelodysplastic syndrome ( ) Myelodysplastic syndrome ( )
UniProt ID	TIFAB_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00498
Sequence	MEKPLTVLRVSLYHPTLGPSAFANVPPRLQHDTSPLLLGRGQDAHLQLQLPRLSRRHLSL EPYLEKGSALLAFCLKALSRKGCVWVNGLTLRYLEQVPLSTVNRVSFSGIQMLVRVEEGT SLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQGQPPPGSG
Function	Inhibits TIFA-mediated TRAF6 activation possibly by inducing a conformational change in TIFA.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Aural atresia, congenital	DISCP7UV	Strong	Genetic Variation	[1]
Childhood myelodysplastic syndrome	DISMN80I	Strong	Biomarker	[2]
Myelodysplastic syndrome	DISYHNUI	Strong	Biomarker	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Malathion	DMXZ84M	Approved	Malathion decreases the expression of TRAF-interacting protein with FHA domain-containing protein B (TIFAB).	[3]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of TRAF-interacting protein with FHA domain-containing protein B (TIFAB).	[4]
------------------------------------------------------------------------------------

References

1	Identification of the TIFAB Gene as a Susceptibility Locus for Coronary Artery Aneurysm in Patients with Kawasaki Disease.Pediatr Cardiol. 2019 Mar;40(3):483-488. doi: 10.1007/s00246-018-1992-7. Epub 2018 Sep 28.
2	Epistasis between TIFAB and miR-146a: neighboring genes in del(5q) myelodysplastic syndrome.Leukemia. 2017 Jul;31(7):1659. doi: 10.1038/leu.2017.95. Epub 2017 Apr 7.
3	Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
4	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.