Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCPE947)

DOT Name	Sperm axonemal maintenance protein CFAP97D1 (CFAP97D1)
Synonyms	CFAP97 domain-containing protein 1
Gene Name	CFAP97D1
UniProt ID	CF97D_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF13879
Sequence	MNNSLDYLAYPVIVSNHRQSTTFRKKLDFGHYVSHKNRIQIAKPTVDTKPPVAHTNHILK LSKLQGEQKKINKIEYENKQLCQKIANAHRGPAKVDCWNEYFSKSLNRETRNRELVRITM ENQGILKRLVDRKPHYDRRASEIDWQNSRRYIRNTTRYLLSQNE
Function	Required for male fertility through its role in axonemal doublet stabilization which is essential for sperm motility and fertilization.
Tissue Specificity	Expressed exclusively in testis.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Sperm axonemal maintenance protein CFAP97D1 (CFAP97D1).	[1]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Sperm axonemal maintenance protein CFAP97D1 (CFAP97D1).	[2]
------------------------------------------------------------------------------------

References

1	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
2	Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.