Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCYCROR)

• DOT Name: P2Y purinoceptor 4 (P2RY4)
• Synonyms: P2Y4; P2P; Uridine nucleotide receptor; UNR
• Gene Name: P2RY4
• UniProt ID: P2RY4_HUMAN
• Pfam ID: PF00001
• Sequence:
  MASTESSLLRSLGLSPGPGSSEVELDCWFDEDFKFILLPVSYAVVFVLGLGLNAPTLWLF
  IFRLRPWDATATYMFHLALSDTLYVLSLPTLIYYYAAHNHWPFGTEICKFVRFLFYWNLY
  CSVLFLTCISVHRYLGICHPLRALRWGRPRLAGLLCLAVWLVVAGCLVPNLFFVTTSNKG
  TTVLCHDTTRPEEFDHYVHFSSAVMGLLFGVPCLVTLVCYGLMARRLYQPLPGSAQSSSR
  LRSLRTIAVVLTVFAVCFVPFHITRTIYYLARLLEADCRVLNIVNVVYKVTRPLASANSC
  LDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVSLPEDSSCRWAATPQDSSCSTP
  RADRL
• Function: Receptor for UTP and UDP coupled to G-proteins that activate a phosphatidylinositol-calcium second messenger system. Not activated by ATP or ADP.
• Tissue Specificity: Pancreas.
• KEGG Pathway:
  Neuroactive ligand-receptor interaction (hsa04080)
  Taste transduction (hsa04742)
• Reactome Pathway:
  G alpha (i) signalling events (R-HSA-418594)
  P2Y receptors (R-HSA-417957)

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of P2Y purinoceptor 4 (P2RY4).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of P2Y purinoceptor 4 (P2RY4).	[3]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PAI-1	DMY2AEF	Phase 4	PAI-1 decreases the expression of P2Y purinoceptor 4 (P2RY4).	[2]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Pseudomonas aeruginosa quorum-sensing signal molecule N-(3-oxododecanoyl)-L-homoserine lactone inhibits expression of P2Y receptors in cystic fibrosis tracheal gland cells. Infect Immun. 1999 Oct;67(10):5076-82. doi: 10.1128/IAI.67.10.5076-5082.1999.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.