Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDWAJ2O)

DOT Name	Secreted Ly-6/uPAR domain-containing protein 2 (SLURP2)
Synonyms	Secreted LY6/PLAUR domain-containing protein 2; Secreted Ly-6/uPAR-related protein 2; SLURP-2
Gene Name	SLURP2
Related Disease	Psoriasis ( )
UniProt ID	SLUR2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	2N99
Pfam ID	PF00021
Sequence	MQLGTGLLLAAVLSLQLAAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTED LPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD
Function	Binds and may modulate the functional properties of nicotinic and muscarinic acetylcholine receptors. May regulate keratinocytes proliferation, differentiation and apoptosis. In vitro moderately inhibits ACh-evoked currents of alpha-3:beta-2-containing nAChRs and strongly these of alpha-4:beta-2-containing nAChRs, modulates alpha-7-containing nAChRs, and inhibits nicotine-induced signaling probably implicating alpha-3:beta-4-containing nAChRs. Proposed to act on alpha-3:beta-2 and alpha-7 nAChRs in an orthosteric, and on mAChRs, such as CHRM1 and CHRM3, in an allosteric manner.
Tissue Specificity	Expressed at highest levels in cervix and esophagus, followed by adult and fetal skin. Expressed at lower levels in brain, lung, stomach, small intestine, colon, rectum, uterus, and thymus. Not detected in spleen nor bone marrow. Up-regulated 3-fold in psoriatic lesional skin . In the epidermis, predominantly produced by keratinocytes of the suprabasal epidermal compartment (at protein level) . In attached gingiva, produced at highest levels by basal cells located in the lowermost epithelial layers (at protein level) . Detected in serum (at protein level) .
KEGG Pathway	Neuroactive ligand-receptor interaction (hsa04080 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Psoriasis	DIS59VMN	Strong	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Secreted Ly-6/uPAR domain-containing protein 2 (SLURP2).	[2]
------------------------------------------------------------------------------------

References

1	SLURP-2, a novel member of the human Ly-6 superfamily that is up-regulated in psoriasis vulgaris.Genomics. 2003 Jan;81(1):26-33. doi: 10.1016/s0888-7543(02)00025-3.
2	Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.