Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTERP9MX)

DOT Name Transcription elongation factor A N-terminal and central domain-containing protein (TCEANC)
Synonyms TFIIS central domain-containing protein 1
Gene Name TCEANC
Related Disease
High blood pressure ( )
Obsolete male infertility with azoospermia or oligozoospermia due to single gene mutation ( )
UniProt ID
TEANC_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF08711 ; PF07500
Sequence
MSDKNQIAARASLIEQLMSKRNFEDLGNHLTELETIYVTKEHLQETDVVRAVYRVLKNCP
SVALKKKAKCLLSKWKAVYKQTHSKARNSPKLFPVRGNKEENSGPSHDPSQNETLGICSS
NSLSSQDVAKLSEMIVPENRAIQLKPKEEHFGDGDPESTGKRSSELLDPTTPMRTKCIEL
LYAALTSSSTDQPKADLWQNFAREIEEHVFTLYSKNIKKYKTCIRSKVANLKNPRNSHLQ
QNLLSGTTSPREFAEMTVMEMANKELKQLRASYTESCIQEHYLPQVIDGTQTNKIKCRRC
EKYNCKVTVIDRGTLFLPSWVRNSNPDEQMMTYVICNECGEQWYHSKWVCW

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
High blood pressure DISY2OHH moderate Genetic Variation [1]
Obsolete male infertility with azoospermia or oligozoospermia due to single gene mutation DIS56JR8 Limited X-linked [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Transcription elongation factor A N-terminal and central domain-containing protein (TCEANC). [3]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Transcription elongation factor A N-terminal and central domain-containing protein (TCEANC). [4]
Hydroquinone DM6AVR4 Approved Hydroquinone decreases the expression of Transcription elongation factor A N-terminal and central domain-containing protein (TCEANC). [5]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Transcription elongation factor A N-terminal and central domain-containing protein (TCEANC). [6]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Transcription elongation factor A N-terminal and central domain-containing protein (TCEANC). [7]
------------------------------------------------------------------------------------

References

1 Genome Wide Association Study Identifies L3MBTL4 as a Novel Susceptibility Gene for Hypertension.Sci Rep. 2016 Aug 2;6:30811. doi: 10.1038/srep30811.
2 A genomics approach to male infertility. Genet Med. 2020 Dec;22(12):1967-1975. doi: 10.1038/s41436-020-0916-0. Epub 2020 Jul 28.
3 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
4 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
5 Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
6 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
7 Characterization of the Molecular Alterations Induced by the Prolonged Exposure of Normal Colon Mucosa and Colon Cancer Cells to Low-Dose Bisphenol A. Int J Mol Sci. 2022 Oct 1;23(19):11620. doi: 10.3390/ijms231911620.