Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFJOWT4)

DOT Name	Potassium channel subfamily K member 7 (KCNK7)
Gene Name	KCNK7
Related Disease	Atrial fibrillation ( )
UniProt ID	KCNK7_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF07885
Sequence	MGGLRPWSRYGLLVVAHLLALGLGAVVFQALEGPPACRLQAELRAELAAFQAEHRACLPP GALEELLGTALATQAHGVSTLGNSSEGRTWDLPSALLFAASILTTTGYGHMAPLSPGGKA FCMVYAALGLPASLALVATLRHCLLPVLSRPRAWVAVHWQLSPARAALLQAVALGLLVAS SFVLLPALVLWGLQGDCSLLGAVYFCFSSLSTIGLEDLLPGRGRSLHPVIYHLGQLALLG YLLLGLLAMLLAVETFSELPQVRAMGKFFRPSGPVTAEDQGGILGQDELALSTLPPAAPA SGQAPAC
Function	Probable potassium channel subunit. No channel activity observed in vitro as protein remains in the endoplasmic reticulum. May need to associate with an as yet unknown partner in order to reach the plasma membrane.
Reactome Pathway	Phase 4 - resting membrane potential (R-HSA-5576886 ) Tandem of pore domain in a weak inwardly rectifying K+ channels (TWIK) (R-HSA-1299308 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Potassium channel subfamily K member 7 (KCNK7).	[2]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Potassium channel subfamily K member 7 (KCNK7).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Potassium channel subfamily K member 7 (KCNK7).	[7]
------------------------------------------------------------------------------------

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Potassium channel subfamily K member 7 (KCNK7).	[3]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Potassium channel subfamily K member 7 (KCNK7).	[5]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Potassium channel subfamily K member 7 (KCNK7).	[6]
------------------------------------------------------------------------------------

References

1	TASK-1 current is inhibited by phosphorylation during human and canine chronic atrial fibrillation.Am J Physiol Heart Circ Physiol. 2015 Jan 15;308(2):H126-34. doi: 10.1152/ajpheart.00614.2014. Epub 2014 Nov 26.
2	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
4	Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
5	The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
6	The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
7	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.