Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFYE6AJ)

DOT Name	p21 protein (HRAS)
Gene Name	HRAS
UniProt ID	P78460_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00071
Sequence	MTEYKLVVVGAGGVGKSALTIQLIQNHFVD

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 4 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Indomethacin	DMSC4A7	Approved	p21 protein (HRAS) increases the Cytology abnormal ADR of Indomethacin.	[1]
Zidovudine	DM4KI7O	Approved	p21 protein (HRAS) increases the Cell death ADR of Zidovudine.	[1]
Digoxin	DMQCTIH	Approved	p21 protein (HRAS) increases the Tumour necrosis ADR of Digoxin.	[1]
NVP-LAQ824	DM8JWNA	Phase 3	p21 protein (HRAS) increases the Apoptosis ADR of NVP-LAQ824.	[1]
------------------------------------------------------------------------------------

References

1	ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.