Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGJV5UZ)

DOT Name	Protein SSX3 (SSX3)
Synonyms	Cancer/testis antigen 5.3; CT5.3
Gene Name	SSX3
Related Disease	Neoplasm ( ) Synovial sarcoma ( ) Advanced cancer ( )
UniProt ID	SSX3_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF09514
Sequence	MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTK LGFKAILPSFMRNKRVTDFQGNDFDNDPNRGNQVQRPQMTFGRLQGIFPKIMPKKPAEEG NVSKEVPEASGPQNDGKQLCPPGKPTTSEKINMISGPKRGEHAWTHRLRERKQLVIYEEI SDPEEDDE
Function	Could act as a modulator of transcription.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Neoplasm	DISZKGEW	Strong	Altered Expression	[1]
Synovial sarcoma	DISEZJS7	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[3]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Protein SSX3 (SSX3).	[4]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Protein SSX3 (SSX3).	[5]
------------------------------------------------------------------------------------

References

1	Expression of SSX genes in human tumors.Int J Cancer. 1998 Jul 3;77(1):19-23. doi: 10.1002/(sici)1097-0215(19980703)77:1<19::aid-ijc4>3.0.co;2-2.
2	A novel Krppel-associated box containing the SSX gene (SSX3) on the human X chromosome is not implicated in t(X;18)-positive synovial sarcomas.Cytogenet Cell Genet. 1996;73(3):179-83. doi: 10.1159/000134334.
3	SSX2-4 expression in early-stage non-small cell lung cancer.Tissue Antigens. 2014 May;83(5):344-9. doi: 10.1111/tan.12340. Epub 2014 Mar 20.
4	The DNA demethylating agent 5-aza-2'-deoxycytidine induces expression of NY-ESO-1 and other cancer/testis antigens in myeloid leukemia cells. Leuk Res. 2010 Jul;34(7):899-905. doi: 10.1016/j.leukres.2010.02.004. Epub 2010 Apr 10.
5	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.