Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGWRSI2)

DOT Name	Transcription factor LBX2 (LBX2)
Synonyms	Ladybird homeobox 2; Ladybird homeobox protein homolog 2
Gene Name	LBX2
Related Disease	Alstrom syndrome ( ) Esophageal squamous cell carcinoma ( ) Gastric cancer ( ) Stomach cancer ( ) Atrial septal defect ( )
UniProt ID	LBX2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00046
Sequence	MNSGREPRTPRTLLSIADILAPRMVPRAPSAPQLPESGPGPTSPLCALEELTSKTFRGLD ARALQPSEGRAGPDALGPGPFGRKRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLAT RLGLANAQVVTWFQNRRAKLKRDVEEMRADVASLRALSPEVLCSLALPEGAPDPGLCLGP AGPDSRPHLSDEEIQVDD
Function	Transcription factor.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Alstrom syndrome	DISFVX55	Strong	Altered Expression	[1]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[2]
Gastric cancer	DISXGOUK	Disputed	Biomarker	[3]
Stomach cancer	DISKIJSX	Disputed	Biomarker	[3]
Atrial septal defect	DISJT76B	Limited	Genetic Variation	[4]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Transcription factor LBX2 (LBX2).	[5]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Transcription factor LBX2 (LBX2).	[6]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Transcription factor LBX2 (LBX2).	[7]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Transcription factor LBX2 (LBX2).	[9]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Transcription factor LBX2 (LBX2).	[8]
------------------------------------------------------------------------------------

References

1	Characterization of the murine Lbx2 promoter, identification of the human homologue, and evaluation as a candidate for Alstrm syndrome.Genomics. 2001 Jun 1;74(2):219-27. doi: 10.1006/geno.2001.6539.
2	LBX2-AS1 is activated by ZEB1 and promotes the development of esophageal squamous cell carcinoma by interacting with HNRNPC toenhance the stability of ZEB1 and ZEB2 mRNAs.Biochem Biophys Res Commun. 2019 Apr 9;511(3):566-572. doi: 10.1016/j.bbrc.2019.02.079. Epub 2019 Feb 26.
3	LBX2-AS1/miR-219a-2-3p/FUS/LBX2 positive feedback loop contributes to the proliferation of gastric cancer.Gastric Cancer. 2020 May;23(3):449-463. doi: 10.1007/s10120-019-01019-6. Epub 2019 Oct 31.
4	Identification of LBX2 as a novel causal gene of atrial septal defect.Int J Cardiol. 2018 Aug 15;265:188-194. doi: 10.1016/j.ijcard.2018.04.038. Epub 2018 Apr 11.
5	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6	Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
7	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
8	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
9	Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.