Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTH3LAUX)

DOT Name	Membrane-spanning 4-domains subfamily A member 10 (MS4A10)
Synonyms	CD20 antigen-like 7
Gene Name	MS4A10
UniProt ID	M4A10_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF04103
Sequence	MKAEATVIPSRCARGLPSWQVLSPVQPWQTSAPQNTTQPKLLAPHQHEKSQKKSSLLKEL GAFHITIALLHLVFGGYLASIVKNLHLVVLKSWYPFWGAASFLISGILAITMKTFSKTYL KMLCLMTNLISLFCVLSGLFVISKDLFLESPFESPIWRMYPNSTVHIQRLELALLCFTVL ELFLPVPTAVTAWRGDCPSAKNDDACLVPNTPLHLKGLPVEPPPSYQSVIQGDAQHKQHQ RLREVKQVAPDTWIVTDGAAIWTQTAN
Function	May be involved in signal transduction as a component of a multimeric receptor complex.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Membrane-spanning 4-domains subfamily A member 10 (MS4A10).	[1]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of Membrane-spanning 4-domains subfamily A member 10 (MS4A10).	[1]
Fenofibrate	DMFKXDY	Approved	Fenofibrate decreases the expression of Membrane-spanning 4-domains subfamily A member 10 (MS4A10).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Membrane-spanning 4-domains subfamily A member 10 (MS4A10).	[2]
------------------------------------------------------------------------------------

References

1	Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
2	Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.