Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHHFM2Z)

• DOT Name: Cilia- and flagella-associated protein 100 (CFAP100)
• Synonyms: Coiled-coil domain-containing protein 37
• Gene Name: CFAP100
• Related Disease:
  Chronic obstructive pulmonary disease
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Neoplasm
• UniProt ID: CP100_HUMAN
• PDB ID: 8J07
• Pfam ID: PF13863
• Sequence:
  MSEIPSTIVSKNMTNDKNSLESMNISSSSSTEENPKKQARKNEEHGPDPSANPFHLSGDV
  DFFLLRDQERNKALSERQQQKTMRVHQKMTYSSKVSAKHTSLRRQLQLEDKQEDLEARAE
  AEHQRAFRDYTTWKLTLTKEKNVEPENMSGYIKQKRQMFLLQYALDVKRREIQRLETLAT
  KEEARLERAEKSLEKDAALFDEFVRENDCSSVQAMRAAEKETKAKIEKILEIRDLTTQIV
  NIKSEISRFEDTLKHYKVYKDFLYKLSPKEWLEEQEKKHSFLKKAKEVSEASKESSVNST
  PGDKGPGIKGKASSMWAKEGQGTKKPWRFLQTMRLGRSPSYLSSPQQGSQPSESSGGDSR
  GSNSPIPPTQEDTDSDGEEPQLYFTEPQQLLDVFRELEEQNLSLIQNSQETEKTLEELSH
  TLKHTQIRMDREVNQLKQWVTTMMMSITKEEDTAAELELKARVFHFGEYKGDQQDKLLES
  LNCKVLDVYRHCTGTQQEANLGTVQMLTIIEHQLDELLENLEHVPQVKIEQAERAKEKER
  RIRLREEKLQMQKILQEEHLQRARARAQAEIKKKRGRTLVCRSRPPAHRIKQQSEHTLMD
  KEEEELLFFFT
• Function: May play a role in ciliary/flagellar motility by regulating the assembly and the activity of axonemal inner dynein arm.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Chronic obstructive pulmonary disease	DISQCIRF	moderate	Altered Expression	[1]
Lung cancer	DISCM4YA	moderate	Biomarker	[1]
Lung carcinoma	DISTR26C	moderate	Biomarker	[1]
Lung neoplasm	DISVARNB	moderate	Posttranslational Modification	[1]
Neoplasm	DISZKGEW	moderate	Posttranslational Modification	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Cilia- and flagella-associated protein 100 (CFAP100).	[2]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Cilia- and flagella-associated protein 100 (CFAP100).	[2]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Cilia- and flagella-associated protein 100 (CFAP100).	[3]

References

• [1] Epigenetic Repression of CCDC37 and MAP1B Links Chronic Obstructive Pulmonary Disease to Lung Cancer.J Thorac Oncol. 2015 Aug;10(8):1181-8. doi: 10.1097/JTO.0000000000000592.
• [2] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [3] Inter- and intra-laboratory study to determine the reproducibility of toxicogenomics datasets. Toxicology. 2011 Nov 28;290(1):50-8.