Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHP1IZ8)

DOT Name Voltage-dependent calcium channel gamma-7 subunit (CACNG7)
Synonyms Neuronal voltage-gated calcium channel gamma-7 subunit; Transmembrane AMPAR regulatory protein gamma-7; TARP gamma-7
Gene Name CACNG7
UniProt ID
CCG7_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13903
Sequence
MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWR
VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFA
FAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRG
RSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC
Function
Regulates the activity of L-type calcium channels that contain CACNA1C as pore-forming subunit. Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization and by mediating their resensitization. Displays subunit-specific AMPA receptor regulation. Shows specificity only for GRIA1 and GRIA2.
Tissue Specificity Detected in heart left ventricle . Widely expressed.
KEGG Pathway
MAPK sig.ling pathway (hsa04010 )
Cardiac muscle contraction (hsa04260 )
Adrenergic sig.ling in cardiomyocytes (hsa04261 )
Oxytocin sig.ling pathway (hsa04921 )
Hypertrophic cardiomyopathy (hsa05410 )
Arrhythmogenic right ventricular cardiomyopathy (hsa05412 )
Dilated cardiomyopathy (hsa05414 )
Reactome Pathway
Phase 2 - plateau phase (R-HSA-5576893 )
Phase 0 - rapid depolarisation (R-HSA-5576892 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Marinol DM70IK5 Approved Marinol increases the expression of Voltage-dependent calcium channel gamma-7 subunit (CACNG7). [1]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Voltage-dependent calcium channel gamma-7 subunit (CACNG7). [2]
------------------------------------------------------------------------------------

References

1 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
2 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.