Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTI0RW72)

DOT Name	Nuclear RNA export factor 3 (NXF3)
Synonyms	TAP-like protein 3; TAPL-3
Gene Name	NXF3
Related Disease	Cleft palate ( ) Epithelial ovarian cancer ( ) Hepatocellular carcinoma ( ) Isolated cleft palate ( ) Ovarian cancer ( ) Ovarian neoplasm ( )
UniProt ID	NXF3_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF02136 ; PF09162
Sequence	MSLPSGHTTGHTDQVVQRRARCWDIYQRRFSSRSEPVNPGMHSSSHQQQDGDAAMHGAHM DSPVRYTPYTISPYNRKGSFRKQDQTHVNMEREQKPPERRMEGNMPDGTLGSWFKITVPF GIKYNEKWLLNLIQNECSVPFVPVEFHYENMHASFFVENASIAYALKNVSGKIWDEDNEK ISIFVNPAGIPHFVHRELKSEKVEQIKLAMNQQCDVSQEALDIQRLPFYPDMVNRDTKMA SNPRKCMAASLDVHEENIPTVMSAGEMDKWKGIEPGEKCADRSPVCTTFSDTSSNINSIL ELFPKLLCLDGQQSPRATLCGTEAHKRLPTCKGSFFGSEMLKNLVLQFLQQYYLIYDSGD RQGLLSAYHDEACFSLSIPFNPEDSAPSSFCKFFKDSRNIKILKDPYLRGELLKHTKLDI VDSLSALPKTQHDLSSFLVDMWYQTEWMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPG SSSSLCIVNDKLFVRDTSHQGTQSALFTLVPTAFSSSVPAFSQEQQKMLPS
Function	May function as a tissue-specific nuclear mRNA export factor.
Tissue Specificity	Expressed at high level in testis and at low level in a small number of tissues.
KEGG Pathway	Ribosome biogenesis in eukaryotes (hsa03008 ) Nucleocytoplasmic transport (hsa03013 ) mR. surveillance pathway (hsa03015 ) Amyotrophic lateral sclerosis (hsa05014 ) Influenza A (hsa05164 ) Herpes simplex virus 1 infection (hsa05168 )

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Cleft palate	DIS6G5TF	Strong	Biomarker	[1]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[2]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[3]
Isolated cleft palate	DISV80CD	Strong	Biomarker	[1]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[2]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[2]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Disease(s)

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Nuclear RNA export factor 3 (NXF3).	[4]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Nuclear RNA export factor 3 (NXF3).	[5]
------------------------------------------------------------------------------------

References

1	Respiratory failure, cleft palate and epilepsy in the mouse model of human Xq22.1 deletion syndrome.Hum Mol Genet. 2014 Jul 15;23(14):3823-9. doi: 10.1093/hmg/ddu095. Epub 2014 Feb 25.
2	Systematic review: Tumor-associated antigen autoantibodies and ovarian cancer early detection.Gynecol Oncol. 2017 Nov;147(2):465-480. doi: 10.1016/j.ygyno.2017.07.138. Epub 2017 Aug 8.
3	AF119895 regulates NXF3 expression to promote migration and invasion of hepatocellular carcinoma through an interaction with miR-6508-3p.Exp Cell Res. 2018 Feb 1;363(1):129-139. doi: 10.1016/j.yexcr.2017.12.016. Epub 2017 Dec 20.
4	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
5	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.