Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTI77HDK)

• DOT Name: Hairy and enhancer of split-related protein HELT (HELT)
• Synonyms: HES/HEY-like transcription factor
• Gene Name: HELT
• Related Disease:
  Advanced cancer
  Neoplasm
  IgA nephropathy
  Membranous glomerulonephritis
• UniProt ID: HELT_HUMAN
• Pfam ID: PF07527 ; PF00010
• Sequence:
  MSDKLKERKRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQ
  YLRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILA
  FLQSKARLGAEPAFPPLGSLPEPDFSYQLHPAGPEFAGHSPGEAAVFPQGSGAGPFPWPP
  GAARSPALPYLPSAPVPLASPAQQHSPFLTPVQGLDRHYLNLIGHAHPNALNLHTPQHPP
  VL
• Function: Transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3'.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Neoplasm	DISZKGEW	Strong	Biomarker	[1]
IgA nephropathy	DISZ8MTK	moderate	Biomarker	[2]
Membranous glomerulonephritis	DISFSUKQ	Limited	Genetic Variation	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Hairy and enhancer of split-related protein HELT (HELT).	[3]

References

• [1] Evidence-Based Review of BioBran/MGN-3 Arabinoxylan Compound as a Complementary Therapy for Conventional Cancer Treatment.Integr Cancer Ther. 2018 Jun;17(2):165-178. doi: 10.1177/1534735417735379. Epub 2017 Oct 17.
• [2] PDGF-C expression in the developing and normal adult human kidney and in glomerular diseases.J Am Soc Nephrol. 2003 May;14(5):1145-53. doi: 10.1097/01.asn.0000062964.75006.a8.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.