| DOT Name |
Small ribosomal subunit protein eS4, Y isoform 1 (RPS4Y1)
|
| Synonyms |
40S ribosomal protein S4 |
| Gene Name |
RPS4Y1
|
| Related Disease |
- Anxiety ( )
- Anxiety disorder ( )
- Turner syndrome ( )
|
| UniProt ID |
|
| 3D Structure |
|
| PDB ID |
|
| Pfam ID |
PF16121
; PF00467
; PF00900
; PF08071
|
| Sequence |
MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDE
VKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAK
YKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNL
CMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPR
GKGIRLTVAEERDKRLATKQSSG
|
| KEGG Pathway |
- Ribosome (hsa03010 )
- Coro.virus disease - COVID-19 (hsa05171 )
|
| Reactome Pathway |
- Peptide chain elongation (R-HSA-156902 )
- SRP-dependent cotranslational protein targeting to membrane (R-HSA-1799339 )
- Viral mRNA Translation (R-HSA-192823 )
- Selenocysteine synthesis (R-HSA-2408557 )
- Major pathway of rRNA processing in the nucleolus and cytosol (R-HSA-6791226 )
- Translation initiation complex formation (R-HSA-72649 )
- Formation of a pool of free 40S subunits (R-HSA-72689 )
- Formation of the ternary complex, and subsequently, the 43S complex (R-HSA-72695 )
- Ribosomal scanning and start codon recognition (R-HSA-72702 )
- GTP hydrolysis and joining of the 60S ribosomal subunit (R-HSA-72706 )
- Eukaryotic Translation Termination (R-HSA-72764 )
- Regulation of expression of SLITs and ROBOs (R-HSA-9010553 )
- Response of EIF2AK4 (GCN2) to amino acid deficiency (R-HSA-9633012 )
- SARS-CoV-1 modulates host translation machinery (R-HSA-9735869 )
- SARS-CoV-2 modulates host translation machinery (R-HSA-9754678 )
- Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC) (R-HSA-975956 )
- Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC) (R-HSA-975957 )
- L13a-mediated translational silencing of Ceruloplasmin expression (R-HSA-156827 )
|
|
|
|
|
|
|
