Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIOYTJ6)

DOT Name Sperm microtubule inner protein 6 (SPMIP6)
Synonyms Ciliated bronchial epithelial protein 1; Spermatid-specific manchette-related protein 1; Testis development protein NYD-SP22
Gene Name SPMIP6
UniProt ID
SMIP6_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15181
Sequence
MFLFSRKTRTPISTYSDSYRAPTSIKEVYKDPPLCAWEANKFLTPGLTHTMERHVDPEAL
QKMAKCAVQDYTYRGSISGHPYLPEKYWLSQEEADKCSPNYLGSDWYNTWRMEPYNSSCC
NKYTTYLPRLPKEARMETAVRGMPLECPPRPERLNAYEREVMVNMLNSLSRNQQLPRITP
RCGCVDPLPGRLPFHGYESACSGRHYCLRGMDYYASGAPCTDRRLRPWCREQPTMCTSLR
APARNAVCCYNSPAVILPISEP
Function May participate in intramanchette transport and midpiece formation of the sperm tail. May play a potential role in somatic cell proliferation.
Tissue Specificity Expressed in testis . Strongly expressed in ciliated epithelial cells with lower levels in goblet cells (at protein level) .

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Sperm microtubule inner protein 6 (SPMIP6). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the methylation of Sperm microtubule inner protein 6 (SPMIP6). [2]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Sperm microtubule inner protein 6 (SPMIP6). [3]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Sperm microtubule inner protein 6 (SPMIP6). [4]
------------------------------------------------------------------------------------

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
3 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
4 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.