Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIV67IR)

DOT Name U6 snRNA-associated Sm-like protein LSm1 (LSM1)
Synonyms Cancer-associated Sm-like; Small nuclear ribonuclear CaSm
Gene Name LSM1
UniProt ID
LSM1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01423
Sequence
MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIP
RGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDR
GLSIPRADTLDEY
Function
Plays a role in the degradation of histone mRNAs, the only eukaryotic mRNAs that are not polyadenylated. Probably also part of an LSm subunits-containing complex involved in the general process of mRNA degradation.
KEGG Pathway
R. degradation (hsa03018 )
Reactome Pathway
mRNA decay by 5' to 3' exoribonuclease (R-HSA-430039 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of U6 snRNA-associated Sm-like protein LSm1 (LSM1). [1]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of U6 snRNA-associated Sm-like protein LSm1 (LSM1). [2]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of U6 snRNA-associated Sm-like protein LSm1 (LSM1). [3]
Paraquat DMR8O3X Investigative Paraquat increases the expression of U6 snRNA-associated Sm-like protein LSm1 (LSM1). [4]
[3H]methyltrienolone DMTSGOW Investigative [3H]methyltrienolone increases the expression of U6 snRNA-associated Sm-like protein LSm1 (LSM1). [5]
------------------------------------------------------------------------------------

References

1 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
2 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
3 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
4 Mitochondrial damage modulates alternative splicing in neuronal cells: implications for neurodegeneration. J Neurochem. 2007 Jan;100(1):142-53. doi: 10.1111/j.1471-4159.2006.04204.x. Epub 2006 Oct 25.
5 Analysis of the prostate cancer cell line LNCaP transcriptome using a sequencing-by-synthesis approach. BMC Genomics. 2006 Sep 29;7:246. doi: 10.1186/1471-2164-7-246.