Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJ0NSPL)

• DOT Name: Neuronal vesicle trafficking-associated protein 2 (NSG2)
• Synonyms: Neuron-specific protein family member 2; Protein p19; Hmp19
• Gene Name: NSG2
• Related Disease:
  Matthew-Wood syndrome
  Neoplasm
  Advanced cancer
  Mesothelioma
• UniProt ID: NSG2_HUMAN
• Pfam ID: PF06387
• Sequence:
  MVKLNSNPSEKGTKPPSVEDGFQTVPLITPLEVNHLQLPAPEKVIVKTRTEYQPEQKNKG
  KFRVPKIAEFTVTILVSLALAFLACIVFLVVYKAFTYDHSCPEGFVYKHKRCIPASLDAY
  YSSQDPNSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEPKPPKTQGH

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Matthew-Wood syndrome	DISA7HR7	Strong	Altered Expression	[1]
Neoplasm	DISZKGEW	Strong	Biomarker	[1]
Advanced cancer	DISAT1Z9	Disputed	Posttranslational Modification	[2]
Mesothelioma	DISKWK9M	Disputed	Biomarker	[2]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Neuronal vesicle trafficking-associated protein 2 (NSG2) affects the response to substance of Doxorubicin.	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Neuronal vesicle trafficking-associated protein 2 (NSG2).	[3]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Neuronal vesicle trafficking-associated protein 2 (NSG2).	[4]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Neuronal vesicle trafficking-associated protein 2 (NSG2).	[5]

References

• [1] Suppression of pancreatic cancer growth and metastasis by HMP19 identified through genome-wide shRNA screen.Int J Cancer. 2016 Aug 1;139(3):628-38. doi: 10.1002/ijc.30110.
• [2] Long-Fiber Carbon Nanotubes Replicate Asbestos-Induced Mesothelioma with Disruption of the Tumor Suppressor Gene Cdkn2a (Ink4a/Arf).Curr Biol. 2017 Nov 6;27(21):3302-3314.e6. doi: 10.1016/j.cub.2017.09.007.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Gene expression changes associated with altered growth and differentiation in benzo[a]pyrene or arsenic exposed normal human epidermal keratinocytes. J Appl Toxicol. 2008 May;28(4):491-508.
• [5] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [6] Prediction of doxorubicin sensitivity in breast tumors based on gene expression profiles of drug-resistant cell lines correlates with patient survival. Oncogene. 2005 Nov 17;24(51):7542-51. doi: 10.1038/sj.onc.1208908.