General Information of Drug Off-Target (DOT) (ID: OTJF6GFU)

DOT Name Pro-neuregulin-4, membrane-bound isoform (NRG4)
Synonyms Pro-NRG4
Gene Name NRG4
UniProt ID
NRG4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00008
Sequence
MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSN
LFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH
Function
Low affinity ligand for the ERBB4 tyrosine kinase receptor. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. Does not bind to the ERBB1, ERBB2 and ERBB3 receptors.
KEGG Pathway
ErbB sig.ling pathway (hsa04012 )
Amyotrophic lateral sclerosis (hsa05014 )
Reactome Pathway
Signaling by ERBB4 (R-HSA-1236394 )
SHC1 events in ERBB2 signaling (R-HSA-1250196 )
PI3K events in ERBB4 signaling (R-HSA-1250342 )
SHC1 events in ERBB4 signaling (R-HSA-1250347 )
Nuclear signaling by ERBB4 (R-HSA-1251985 )
PIP3 activates AKT signaling (R-HSA-1257604 )
GRB2 events in ERBB2 signaling (R-HSA-1963640 )
PI3K events in ERBB2 signaling (R-HSA-1963642 )
Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530 )
RAF/MAP kinase cascade (R-HSA-5673001 )
ERBB2 Regulates Cell Motility (R-HSA-6785631 )
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558 )
ERBB2 Activates PTK6 Signaling (R-HSA-8847993 )
Downregulation of ERBB2 signaling (R-HSA-8863795 )
Signaling by ERBB2 KD Mutants (R-HSA-9664565 )
Signaling by ERBB2 TMD/JMD mutants (R-HSA-9665686 )
Signaling by ERBB2 (R-HSA-1227986 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Pro-neuregulin-4, membrane-bound isoform (NRG4). [1]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Pro-neuregulin-4, membrane-bound isoform (NRG4). [2]
------------------------------------------------------------------------------------

References

1 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
2 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.