Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJTMY5T)

• DOT Name: Peptidyl-prolyl cis-trans isomerase A-like 4A (PPIAL4A)
• Synonyms: PPIase A-like 4A; EC 5.2.1.8; Chromosome one-amplified sequence 2; COAS-2; Cyclophilin homolog overexpressed in liver cancer
• Gene Name: PPIAL4A
• UniProt ID: PAL4A_HUMAN
• EC Number: 5.2.1.8
• Pfam ID: PF00160
• Sequence:
  MVNSVVFFDITVDGKPLGRISIKLFADKILKTAENFRALSTGEKGFRYKGSCFHRIIPGF
  MCQGGDFTRHNGTGDKSIYGEKFDDENLIRKHTGSGILSMANAGPNTNGSQFFICAAKTE
  WLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKITIADCGQF
• Function: PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
• Tissue Specificity: Highly expressed in brain, ovary and mammary gland. Moderately expressed in lung, salivary gland, kidney, skin, adipose tissue, intestine and spleen. Weakly expressed in skeletal muscle, liver and stomach. Expressed in pleiomorphic and undifferentiated liposarcomas, osteosarcomas and breast carcinomas.

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Peptidyl-prolyl cis-trans isomerase A-like 4A (PPIAL4A).	[1]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Peptidyl-prolyl cis-trans isomerase A-like 4A (PPIAL4A).	[3]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Peptidyl-prolyl cis-trans isomerase A-like 4A (PPIAL4A).	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Peptidyl-prolyl cis-trans isomerase A-like 4A (PPIAL4A).	[2]

References

• [1] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [2] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [3] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [4] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.