Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJX3N64)

• DOT Name: Ribosomal protein uL30-like (RPL7L1)
• Synonyms: 60S ribosomal protein L7-like 1; Large ribosomal subunit protein uL30-like 1
• Gene Name: RPL7L1
• UniProt ID: RL7L_HUMAN
• PDB ID: 8FKP; 8FKQ; 8FKR; 8FKS; 8FKT; 8FKU; 8FKV; 8FKW; 8FKX; 8FKY; 8FKZ; 8FL2; 8FL3; 8FL4; 8FL6; 8FL7; 8FLA; 8FLB; 8FLD; 8FLE; 8INE; 8INF; 8IPX; 8IPY; 8IR3
• Pfam ID: PF00327 ; PF08079
• Sequence:
  MISSCTTRKMAEQEQRKIPLVPENLLKKRKAYQALKATQAKQALLAKKEQKKGKGLRFKR
  LESFLHDSWRQKRDKVRLRRLEVKPHALELPDKHSLAFVVRIERIDGVSLLVQRTIARLR
  LKKIFSGVFVKVTPQNLKMLRIVEPYVTWGFPNLKSVRELILKRGQAKVKNKTIPLTDNT
  VIEEHLGKFGVICLEDLIHEIAFPGKHFQEISWFLCPFHLSVARHATKNRVGFLKEMGTP
  GYRGERINQLIRQLN

Molecular Interaction Atlas (MIA) of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Ribosomal protein uL30-like (RPL7L1).	[1]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Ribosomal protein uL30-like (RPL7L1).	[2]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Ribosomal protein uL30-like (RPL7L1).	[4]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Ribosomal protein uL30-like (RPL7L1).	[5]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Ribosomal protein uL30-like (RPL7L1).	[3]

References

• [1] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [2] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [4] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [5] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.